KEGG   Mus pahari (shrew mouse): 110333070Help
Entry
110333070         CDS       T05929                                 

Gene name
Iws1
Definition
(RefSeq) protein IWS1 homolog
  KO
K17498  transcription factor SPN1
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mpah03021]
    110333070 (Iws1)
Transcription machinery [BR:mpah03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     110333070 (Iws1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 110333070
NCBI-ProteinID: XP_021070136
Ensembl: MGP_PahariEiJ_G0018806
Position
15
AA seq 765 aa AA seqDB search
MDSEYYSGDQSDDGGATPVQDERDSGSDGEDGVTEQHSGSDTGSIDHHSENETSDREDGL
VKIHNGTDSENDEPSNANASDSESEELHRPKDSDSDSEEHAESPASDSENEAVNQHGSDS
ENEELLNGHASDSEKEEVRKHTASDSETEDPLQPQVSESDSEDPPRPQASDSENEEPPKP
RISDSESEELPKPRISDSENEDPPRPQASDSESEELPKPRVSDSESEDPPRPQASDSESE
ELPKPRVSDSESEDPQKGPASDSEAEDASRHKEKPESDDSDGENKREDSEVQNESDGHAD
RKGLHSSDSEEEEPKRQKIDSDDDEEKEGDEEKVAKRKAAVLSDSEDDDKASAKKSRVVS
DADDSDSDVVSDKSGKREKTVASDSEEEAGKEEPSVKKKEEKDLFGSDSESGNEEENLIA
DIFGESGDEEEEEFTGFNQEDLEEEKNEAQLKEAEDSDSDDNIKRGKHMDFLSDFEMMLQ
RKKSMCGKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPTV
VMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKH
SGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQ
RRRMSSTGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEMES
SRFQASSKKGISRLDKQMRKFTDIRKKSRSAHAVKISIEGNKMPL
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggactcggagtactacagcggggaccagtcagatgatggtggtgcaaccccagtacag
gacgagcgggattcagggtcagatggtgaggatggtgtaaccgagcagcactccggatcc
gacactggaagtatagaccaccactcagagaatgaaactagtgatagagaagatggcttg
gtcaagatacataatggaacagactctgagaatgatgaaccttccaatgctaatgccagt
gactctgaaagtgaggagcttcacaggccaaaggacagtgactctgactctgaggaacat
gcagagtctccagccagtgattctgaaaatgaagctgtcaaccaacatgggagcgactct
gaaaatgaagagctccttaatgggcatgccagtgactctgaaaaggaagaggttagaaag
catacagccagtgactctgaaactgaggaccctctgcagcctcaggtcagcgagtctgac
agcgaagatcccccaaggccccaggccagtgactcagaaaatgaggagcctcccaaacct
cggataagtgattcagaaagtgaggagctccccaaaccccggatcagtgactcagaaaac
gaggatcccccaaggccccaggccagtgactcggaaagcgaggagctccccaaaccccga
gtcagtgattcagaaagtgaggatcccccaaggccccaggccagtgactcggaaagcgag
gagctccccaaacccagagtcagcgactcagaaagtgaggaccctcagaaaggacctgct
agtgattctgaagctgaggatgcctccaggcacaaagaaaagccagaatcagatgacagt
gatggggagaataagagagaagattctgaagtgcagaatgagtcagatggccatgcagac
agaaaaggactccacagctctgacagtgaggaggaagaacccaaaaggcaaaaaattgac
agtgatgatgatgaagaaaaggagggggatgaggagaaagtagcgaagcggaaggctgct
gtgctttctgatagtgaggatgatgacaaagcctcagcaaagaagagtcgagttgtctct
gatgctgatgactctgatagtgatgttgtatcagacaagtcaggcaaaagagagaagaca
gtagcgtctgacagtgaagaagaagccgggaaagaagagccttctgtaaagaagaaggaa
gagaaggatctgtttgggagtgatagtgaatcaggcaatgaagaagaaaatcttattgca
gatatatttggagaatctggtgatgaagaggaagaggaatttacgggttttaaccaagaa
gatttggaggaagagaaaaacgaagcacagctaaaagaagcagaagattctgattccgat
gataacataaagagaggcaagcatatggactttctgtcagattttgagatgatgttacaa
cgaaaaaaaagcatgtgtggcaaacgcagacgaaatcgagatgggggcacttttattagt
gatgcagatgatgttgtgagcgccatgattgtcaagatgaatgaagctgctgaggaagac
agacaattgaataatcaaaaaaagccagctctgaaaaaattaactttattgcctactgtg
gttatgcaccttaaaaagcaggaccttaaagaaacatttattgacagtggtgtgatgtct
gccattaaagaatggctctcacctctaccagataggagtttgcctgcactgaagattcgg
gaggaattgttaaagattctgcaagagctacctagtgtgagccaagagaccctgaagcat
agtgggattggccgagcagtgatgtatctgtataaacaccctaaggagtcaaggtccaac
aaggacatggcagggaagctcatcaatgagtggtctcggcccatatttggtcttacctca
aactataaaggaatgacaagagaagaaagggagcagagagatctagaacaaatgccacag
cgacgaagaatgagcagcactggtggtcagacaccacgaagagacctggaaaaggtacta
acaggagaagaaaaggctcttaggcctggagatcctggcttctgtgcccgtgcaagagtc
ccaatgccatcaaacaaggactatgttgtcaggcccaagtggaatgtagaaatggagtca
tccaggtttcaggcatcctccaagaaaggtatcagtcgactggataaacagatgagaaag
ttcacagatatcaggaaaaaaagcagatctgcacatgcagtgaaaatcagcatcgagggc
aataaaatgccattgtga

DBGET integrated database retrieval system