KEGG   Mus pahari (shrew mouse): 110333397
Entry
110333397         CDS       T05929                                 

Gene name
Lvrn
Definition
(RefSeq) aminopeptidase Q
  KO
K13724  aminopeptidase Q [EC:3.4.11.-]
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110333397 (Lvrn)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     110333397 (Lvrn)
Peptidases and inhibitors [BR:mpah01002]
 Metallo peptidases
  Family M1
   110333397 (Lvrn)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 110333397
NCBI-ProteinID: XP_021070657
Ensembl: MGP_PahariEiJ_G0018992
Position
15
AA seq 989 aa
MSPPFSSGIYVSRRVALLLAGLTAVLLLVLVALAALYGSCAHIQSSEQDNPWAKNTSLWP
PGGQELALPTPAQEPTVGTSQDLGPPSGPWDHLRLPPWLVPLHYDLELWPWLQPDKLSPP
NLTFTGRVNITVRCTAATSRLLLHSFLLNYKQVEVWGPLAPDPRNATVGRVPVEKVWFAP
DMQFVVLDLGQSLEPGSSYELNFDFSGQVLQVGLEGLFLNLYHDEDELRALVATQMEPTF
ARHVFPCFDEPALKATFNITIIHHPGYAALSNMPQLGQSERIDVNGSRWTVTSFHTTPRM
PTYLVALVVCDLDHVSRTERGKEIRVWARKDDIANGYLDFAANVTGPVFSFLEDLFNISY
RLPKTDIVALPIFASGAMENWGLLIFDESSLLLEPEDELTEKKAMILSIIAHEVGHQWFG
NLVTMSWWNNIWLNEGFASYFELELTNYFYPKVPMNMIFFFTILHGILGEDHALESRAVS
TAVENFTETSEINRLFDLYTYKKGACMAWMLASFLSQHLFINALKSYLETFSYSNAEQDD
LWRHIQMAIGEQSVIHLPATVKSIMDSWTHRGGFPIITVNVSTGVVKQEPFYLDKVENQT
LLSHNSTWIVPIFWMKNGIPQPLVWLDKSNMMFPGMKLSDSGSDWVILNFNVTGYYRVNY
DELGWKKLSQQLEKDPKAIPVINRLQLVSDAFALTKNNYIEIETALDLTKYIAEEDEILV
WFEVLVNLINREVIYDVNNYALYPLLKKYLLKRFNSIWNTYSAIIRENVASLQENYLSLL
SLEKIFETACWLGLEDCLQLSRELFRKWMAHPETAIPPQIENVVLCSAIALGSDEDWDFL
FNLYINTTEEEVESRRLVHAMSCSKDPWILNRFMEYAITAVPSNFSETNIIVTVAASEVG
RYIAKDFLVDNWVAVTERYGTHWLDALVHVLGRTVSTDQQVTELQHFLSTVLEEHQRVAA
HAKLQAMKAKNLQNKKRIARVVEWLRKNT
NT seq 2970 nt   +upstreamnt  +downstreamnt
atgagccctcctttcagctcaggcatctatgtgagccgcagggtggccctgctgctggcc
gggctgacagccgtgctcctgctggtgctagtggctctggctgccttgtatggcagctgc
gcgcacatccagtcttcggagcaggataacccctgggcgaagaacacctcattgtggcct
cccggcggccaggagttggcgctaccaacccctgcacaggagcccacagtggggacgtcc
caagacttgggacctccgtcggggccctgggatcatctgcgcctgcccccctggcttgtc
ccacttcactatgatctggagctgtggccctggctgcagccggataagctgtccccaccg
aatttgaccttcacaggtcgcgtgaacatcactgtacgctgcacagcggccacctcaaga
ttgttgctgcatagtttccttctgaattacaagcaagtggaagtgtggggtcctctggcc
ccggaccctaggaacgccactgtaggccgcgtgccggtggagaaggtgtggttcgcgccg
gacatgcaattcgtggtgctggatctgggccaatccttggagccaggtagcagttatgaa
ctgaatttcgacttctctggccaggtgcttcaggttggcttagaagggctctttctgaac
ctctaccacgatgaagatgagctcagagccctggtagcaactcaaatggaaccaacattt
gccaggcatgttttcccttgttttgatgagccagctctaaaggcaacttttaatattaca
attatccatcatcctggatatgcggctctttccaatatgccccagctgggtcagtctgaa
agaatcgatgtgaatggaagcagatggactgtcacttccttccataccacaccccgcatg
ccaacgtacctcgttgcccttgttgtatgtgacttagaccacgtcagcagaactgagaga
ggcaaggagatacgtgtctgggcccggaaagacgacattgcaaatggatatttagacttt
gctgcaaacgtcacaggccccgtcttctcctttctggaggatctatttaatatcagttat
cggcttccaaaaacagatatagttgccttgcctatttttgccagcggcgcaatggagaac
tggggcctgttgatatttgacgaatcgtccctgctcctggaaccggaggatgagctaaca
gagaaaaaagctatgatcttgagcatcatcgcccacgaggttgggcaccagtggtttgga
aacctggtgaccatgagctggtggaacaatatctggctcaatgaaggctttgcatcttat
tttgaacttgaactaactaactacttctatcctaaagttcccatgaatatgatctttttt
tttaccatcttacacggtatcctcggagaagatcatgccctggagtctagagctgtgtcc
accgcagtggaaaatttcacagaaacaagcgaaataaacagactctttgacttatatact
tacaagaagggggcgtgcatggcctggatgcttgctagtttcctgagtcagcacttgttt
atcaacgcacttaagtcttatttggagacattttcttactcaaatgcagagcaagacgat
ctgtggagacatattcaaatggccataggtgagcagagtgtaattcatttgccagcaaca
gtaaaaagcataatggacagctggacacaccggggtggctttcctatcatcacagtaaat
gtgtctacgggcgtcgttaaacaagagccgttttatctcgacaaggtggaaaatcagacc
cttctaagccacaatagtacatggattgtccctattttttggatgaagaatggaatccca
caacctttagtctggctagataaaagcaacatgatgtttcctggaatgaaactttcagat
tctggcagtgactgggtgattttaaacttcaatgtgactggatattacagagttaattac
gacgagttaggctggaagaagttaagtcagcaacttgaaaaggatcctaaggccattcct
gtcattaacaggctgcagctggtgagcgacgctttcgccttgactaaaaacaattatatt
gagatcgagacggcacttgatttaaccaagtacattgctgaagaagatgaaatcctggtg
tggtttgaagtcttggtgaacttgataaacagggaagttatttatgatgtgaacaactat
gctttataccctctattgaagaagtatttactaaagagatttaactcaatatggaatact
tattcagctataattcgagaaaatgtggcatcattacaagaaaattatttatctctactt
tcactggaaaagatttttgaaactgcctgttggttgggtcttgaagactgtctccagctg
tccagagagctcttcagaaagtggatggctcatccagagacagcaatacctcctcagatt
gagaacgtggtcttatgcagtgccattgctctggggagtgatgaggactgggactttttg
tttaatctttacatcaatacgaccgaggaagaggtcgagagccgccgtcttgttcacgcg
atgagctgcagtaaagatccatggatacttaacagatttatggagtatgccatcactgcg
gttccctccaattttagtgaaacaaatataatagtcactgtagcagcatctgaagttggc
cggtatattgcaaaggactttctagtggacaactgggtagctgtgactgaaaggtatgga
actcattggctggatgctctagtgcatgtcttagggaggaccgtcagtacagatcaacag
gtcacggagttgcagcacttcctcagcaccgtgttggaggagcaccagagggttgcggct
cacgccaaattacaggcaatgaaggcgaagaatctgcaaaacaagaagagaatcgccagg
gtggttgagtggcttcggaaaaacacgtaa

DBGET integrated database retrieval system