KEGG   Mus pahari (shrew mouse): 110333579Help
Entry
110333579         CDS       T05929                                 

Gene name
Vps41
Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110333579 (Vps41)
Membrane trafficking [BR:mpah04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    110333579 (Vps41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin ANAPC4_WD40 Vps39_1 Vps39_2 zf-RING_5 zf-rbx1 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 110333579
NCBI-ProteinID: XP_021070842
Ensembl: MGP_PahariEiJ_G0019300
Position
16
AA seq 853 aa AA seqDB search
MAEAEEQETESLEESTDESEEESEEEPKLKYERLSNGVTEILQKDAASCMTVHDKFLALG
THYGKVYLLDVQGNITQKFDVSPVKINQISLDDSGEHMGVCSEDGKLQVFGLYSGEEFHE
TFDCPIKIIAVHPQFVRSSCKQFVTGGKKLLLFERTWMNRWKSSVLHEGEGNIRSVKWRG
HLIAWANNMGVKIFDITSKQRITNVPRDDISLRPDMYPCSLCWKDNVTLIIGWGTSIKIC
AVKERHASEMRDLPSRYVEIVSQFETEFYISGLAPLCDQLVVLSYVKEVSEKTEREYCAR
PRLDIIQPLPETCEEISSDALTVRGFQENECRDYHLEYSEGESLFYVVSPRDVVVAKERD
QDDHIDWLLEKKKYEEALMAAEISQRNIKRHKILDIGLAYVNHLVERGEYDMAARKCQKI
LGKNASLWEYEVYKFKEIGQLKAISPYLPRGDPVLKPLIYEMILHEFLESDYEGFATLVR
EWPGDLYNNSVIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQ
LIHKHNLFSSIKDKIVLLMDFDSEKAVDMLLDNEDKISIKKVVEELEDRPELQHVYLHKL
FKRDHHKGQRYHEKQISLYAEYDRPNLLPFLRDSTHCPLEKALEICQQRNFVEETVYLLS
RMGNSRSALKMIMEELHDVDKAIEFAKEQDDGELWEDLILYSIDKPPFITGLLNNIGTHV
DPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQMK
GVLVDEENICESCLSPILPTDAAKPFSVVVFHCRHMFHKECLPMPSMNAPAQYCNICSAK
NRGPGSAILEMKK
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcagaggagcaggaaaccgagtctcttgaagaatctacagatgagtcagag
gaagaaagtgaagaggaacccaaactgaagtatgaaaggctttccaatggggtgacggag
attcttcagaaggatgcagcaagctgtatgacggtccatgacaagtttttggcactgggt
acacattatggcaaggtttatttacttgatgtccagggaaacatcactcagaagtttgat
gtaagtcctgtgaagataaaccagattagcttggatgacagtggagaacacatgggagtg
tgttcagaggatggcaagctacaggtctttggactgtattctggagaagaatttcacgag
actttcgactgtcccattaaaatcattgctgtgcacccacagttcgtgagatccagttgt
aagcagtttgtaactggcgggaaaaagttgctgctatttgaacggacctggatgaacaga
tggaagtcttctgtcctacacgaaggggaagggaacatcaggagtgtgaagtggagaggc
catctgattgcttgggccaacaatatgggtgtgaaaatttttgacatcacctcaaagcaa
agaatcaccaatgttccccgagatgatataagtcttcgcccagatatgtatccctgcagc
ctctgttggaaggacaatgtgacactcattattggctggggaacttccatcaagatatgc
gcagtgaaggaacgccacgccagtgagatgagggatctgccaagtcgatatgttgagata
gtgtctcagtttgaaactgaattctacattagtggacttgcacctctctgtgatcagctt
gttgtactttcctacgtaaaggaggtttcagaaaaaacggaaagagaatactgtgcaaga
cctagactggacatcatccagccacttccggagacgtgtgaagagatctcctccgacgct
ttgacagtcagaggctttcaggagaatgagtgtcgggattaccacttagaatactctgag
ggggaatcactcttctacgtcgtgagtccaagagatgtcgtcgtcgccaaggaacgagac
caggatgatcatatcgactggctccttgagaagaagaaatatgaagaagctttgatggca
gctgaaattagccaaaggaacattaaacgacataagattctggatatcgggttggcatat
gtaaaccacctggtggagagaggagagtacgacatggctgcaagaaaatgccagaaaatt
cttgggaaaaatgcatccctctgggaatatgaagtttacaaatttaaagaaattgggcag
cttaaagcaattagtccctatttacctcgaggggacccagttctgaaaccacttatctat
gaaatgattttgcatgaatttctggaaagtgactatgagggctttgccacactggtcaga
gagtggcctggagatctgtataacaattccgtgatagttcaagcagttcgagaccacctg
aagaaggacagtcagaacaaaacgttattgaaaacactggcagaattgtacacctatgac
aaaaattatggcaatgctctggaaatatacttaacgttaagacataaagatgttttccag
ctgatacacaagcataatcttttcagctccatcaaggataagattgtgttactaatggat
tttgactcagagaaagctgttgatatgcttttggacaatgaagataaaatttcaattaaa
aaagtggtagaagagttagaagacagaccagagctgcagcatgtgtatttgcacaagctc
ttcaagagagaccatcataagggacagcgctaccatgaaaaacagatcagtctgtatgcc
gaatatgaccgaccaaacctacttccctttctccgagacagtacccattgcccacttgaa
aaggcacttgagatctgtcaacaaagaaactttgtagaagagacagtttaccttctgagc
cgaatgggaaacagtcgaagtgccctcaagatgattatggaagaattgcatgatgttgat
aaagcaattgagtttgccaaggaacaagatgatggagagctctgggaagatctgattctg
tattccatcgacaaaccaccatttatcactggcttgttgaacaacattggcacacatgtg
gacccaattttactgatccaccgaattaaggaaggaatggagattcccaatttgagagat
tccttggttaaaattctgcaagattataacttgcagattctgcttcgggaaggctgcaag
aaaatcctcgtagctgactcgttgtcattgctgaaaaaaatgcaccgaacccaaatgaaa
ggcgttctggttgatgaagagaatatctgtgaatcgtgcctttctcctatcctcccaaca
gatgcagcgaagcccttcagtgtggtggtcttccactgccggcacatgttccacaaggag
tgcctgcctatgccgagcatgaatgctcctgcacaatactgcaacatctgtagtgctaag
aaccgtgggcctggaagtgccatcctagagatgaagaagtag

DBGET integrated database retrieval system