KEGG   Mus pahari (shrew mouse): 110333820
Entry
110333820         CDS       T05929                                 

Gene name
C16H9orf3
Definition
(RefSeq) aminopeptidase O
  KO
K09606  aminopeptidase O [EC:3.4.11.-]
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110333820 (C16H9orf3)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     110333820 (C16H9orf3)
Peptidases and inhibitors [BR:mpah01002]
 Metallo peptidases
  Family M1
   110333820 (C16H9orf3)
SSDB
Motif
Pfam: Leuk-A4-hydro_C Peptidase_M1 Peptidase_M1_N
Other DBs
NCBI-GeneID: 110333820
NCBI-ProteinID: XP_021071214
Ensembl: MGP_PahariEiJ_G0019696
Position
16
AA seq 823 aa
MDIKLDPSRDDLPLMANTSHMLVKHYILDLDVDFGNRVIEGNIVLFFGDGNRFKKQSSST
QETSQMESEEADMFRTAEPCHGPEMDSSTFSPKMGHREFAVCSKGDQDAADNDGNHDNQE
HDSEISSSKYCCDTGNHGQKDFLLVLDCCDLSVLKVEEVDVAAVPGLETLTKAPKLLATP
EKLRREIVRDLVALPAGAWREQLDCYSRCSQAPGCGELLFDSDSWSLQIRKTGTRTAADF
PHAIRIWYKTKPEGQSVAWTSDQNGRPCVYTMGSPINNRALFPCQEPPVAMSTWQATVRA
AASFVVLMSGENSAKPTPLREGYMSWHYYVTMPMPASTVAIAVGCWTEMKPKASPSDDLM
TEHALPLPPSEAGLRCDSTCSHVEYPCRFQSVSAATQDIIPYRVFAPVCLEGACQEALLW
LIPPCLSAAHSVLGTHPFSRLDILIVPTNFPSLGMASPHIIFLSQSTLTGTSHLCGTRLC
HEIAHAWFGLAIGARDWTEEWLSEGFATHLEDIFWAEAQQLPPHEALEQQELRACLRWHR
LQDELRNSPEGMQVLRPNKEETGHVSASGASVIKHGLNPEKGFMQVHYLKGYFLLRFLAR
TLGEKIYFPFLRKFVHLFHGQLILSQDFLQMLLESIPENKRLGLSVENIIRDWLECSGIP
KALLEERKAEDCSRSRLAQQVGSEVAKWIRVNRRPRKRKRGKREAAFEKLSPDQIVLLLE
WLLEQKTLSPQTLHCLQQTYHLQEQDAEVRHRWCELVIKHKYTKAYDQVERFLQEDQAMG
IYLYGELMVSEDAGLQQLAYRCFELAKEHMDRASAQVVTEMLF
NT seq 2472 nt   +upstreamnt  +downstreamnt
atggacataaagctggacccttcccgggatgacctgcctctcatggccaacaccagccac
atgcttgtgaagcattacatactggatttggatgtggactttggaaatcgagtcattgag
ggcaacatagtgcttttctttggagatggaaacagatttaaaaaacagtcgagttccacc
caggaaacctcccagatggagtcagaggaggctgacatgtttaggacagctgaaccctgc
catggtcctgagatggattcaagtaccttctcacctaagatgggacatagagaatttgca
gtctgtagtaaaggtgatcaagatgccgctgataacgatggtaaccatgacaaccaggaa
catgattctgagatctctagctcaaagtactgctgtgacacagggaatcatgggcaaaag
gatttcttgctcgtgttggactgctgtgatttatctgtgctaaaggtagaggaggtggat
gtggctgctgtgccaggccttgagacattgactaaagctccaaagctcttggctactcct
gagaagctcaggcgtgagattgtccgtgacctcgtggctctgcctgcaggtgcttggagg
gagcagttagactgctactctcgttgcagccaggctcctggctgtggggagctcttgttt
gactctgacagttggagcttacagatcaggaagaccgggactcggacagctgctgacttt
cctcatgccatcagaatatggtataaaactaaacccgaggggcagtcagtggcttggacc
tcagaccagaatggcaggccatgtgtttatactatgggatcccccatcaacaacagggcc
ctttttccatgccaggaaccacccgttgccatgtcaacatggcaggctacagttcgagca
gctgcatcttttgttgttttaatgagtggagaaaattctgccaagcccacaccacttcga
gaaggatacatgagctggcattactatgtgactatgccaatgccagcctctaccgtggca
attgcagtggggtgctggacagaaatgaagcccaaggcatccccatcagacgatctgatg
actgagcatgctctccccctcccaccatcggaagctggcttgaggtgtgatagcacttgc
agtcatgtggaatacccttgccggttccagagtgtgtctgctgccacccaggacatcatt
ccgtatcgagtgtttgccccagtgtgccttgagggtgcctgccaagaggccctgctgtgg
ttgatccctccttgcctctcagctgcacactctgtcctgggaacacaccctttctcccgg
ctggacattctcattgtccccaccaactttccaagtctggggatggccagcccacacatc
atcttcctctctcagagcaccttaacgggcaccagccatctctgtgggacccgtctttgt
catgaaattgctcacgcctggtttggcctagccattggggcccgagactggacagaggag
tggctcagtgaaggatttgccactcacttggaagatatattttgggctgaagcacagcag
ctgcccccccatgaggccctggagcagcaggagctgagggcttgcctgcgctggcaccgc
ctgcaggatgagcttcggaactccccagaaggaatgcaggtgttaagacccaacaaagaa
gagactggccacgtgagtgcttcaggtgcatctgttatcaagcatggactcaatccagag
aagggcttcatgcaggttcattacttaaagggctacttccttctccggttcctagccaga
acactcggagagaaaatttactttccgttcttaagaaaatttgtgcatctgtttcatggg
cagttgattctttctcaggattttcttcaaatgctgttggagagcattccagaaaacaaa
aggctcggcctgtctgttgagaacatcatccgcgattggcttgagtgttccggaatacct
aaggcgctgctggaggagcgcaaggccgaggactgctcgcggagtaggctcgcacagcaa
gtaggctccgaggtggcgaaatggattcgagtcaaccgcagaccccgaaaacgcaaacga
gggaagcgagaagccgccttcgaaaagctttctccagaccagatcgtcttgcttttggag
tggctcttagagcagaagacgctgagccctcagacactgcattgtctccagcagacttac
catctccaggagcaggatgcagaggttcgccatcgatggtgtgaactggttattaagcac
aagtacacaaaggcatacgatcaggtggagaggttcctacaggaggaccaggccatgggc
atatacctgtatggggagctgatggtgagtgaggatgccggactgcagcagctagcctac
aggtgcttcgagctggcaaaggaacacatggacagagcgtcagcccaggtggtgactgaa
atgctgttctaa

DBGET integrated database retrieval system