KEGG   Mus pahari (shrew mouse): 110334494
Entry
110334494         CDS       T05929                                 

Gene name
Taf2
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription initiation factor TFIID subunit 2
  KO
K03128  transcription initiation factor TFIID subunit 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    110334494 (Taf2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110334494 (Taf2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mpah03021]
    110334494 (Taf2)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110334494 (Taf2)
Peptidases and inhibitors [BR:mpah01002]
 Metallo peptidases
  Family M1
   110334494 (Taf2)
Transcription machinery [BR:mpah03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     110334494 (Taf2)
   Coactivators
    SAGA/TFTC/STAGA complex
     110334494 (Taf2)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     110334494 (Taf2)
SSDB
Motif
Pfam: Peptidase_M1_N RNA_polI_A34 DUF3984
Other DBs
NCBI-GeneID: 110334494
NCBI-ProteinID: XP_021071886
Ensembl: MGP_PahariEiJ_G0019804
Position
17
AA seq 1200 aa
MPPTGLESSRMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANL
NRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPD
AGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSC
GYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTI
PTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYIHEVFEFYEEVLTCRYP
YSCFKTVFIDEAYVEVAAYASMSIFRLVSLQMESAQVKVHTRRSSRLISFETGFEHHVXL
SSXVVWSDEWVLKGISGYIYGLWMKKTFGVNEYHHWIKEELDKIVAYELKTGGVLLHPIF
GGGKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMRLIENRISMEFMLQVFNKLLS
LASTASSQKFQSHMWSQMLVSTYGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFN
RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRR
NKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYELRYERD
VVAQQESILALENFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPA
MKSLFTRMFCCKTCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDL
IKYNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLN
MEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDASLFKSYAEYGHFVDIRIAALEAVVDYT
KVDRSYEELQWLLNMIQTDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMN
SGTAHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPEAGVGNQ
ESASNPGCHTQLAGFQNPFSSSQDEEEVDMDTVHDSQAFISHHLNMLERPSTPGLSKYRP
SGSRSSLMPQHSLGCDITPTAKPQWSMELSRKGAGKEQPLEMGVHSMVAAPLSMFAKEAL
SSRHSEHHHHHHHEHKKKKKKHKHKHKHKHKHDGKDKDKEPFAFSSPASGRSVRSPSLSD
NT seq 3603 nt   +upstreamnt  +downstreamnt
atgccgcccaccggcttagagtcttccaggatgaacaggaagaaaggagacaagggcttc
gaaagcccacggccgtacaaattaacccatcaggtcgtctgtatcaacaacataaacttc
cagcggaaatctgttgtgggatttgtggagctaactatattccctacagttgccaacttg
aatagaatcaagttgaacagtaagcagtgtagaatataccgagtccggatcaatgacttg
gaggctgcttttatttataatgacccaaccttagaagtttgtcacagtgaatcaaaacag
agaaacctcaattatttttccaatgcatatgcagctgcagtcagtgctgtggaccctgat
gcggggaatggagaactctgcattaaggttccctcagagctctggaaacatgtcgatgag
ttgaaagtcctgaagatacatattaatttttctttggatcagccaaaaggaggtcttcat
tttgtggtacccagtgtagaggggagtatggcagagcggggtgctcatgtcttctcttgt
ggttatcaaaattctacaagattttggttcccgtgtgttgattcatactctgagctgtgt
acctggaaattagaatttacagtagatgctgcaatggtagccgtgtccaatggagatttg
gtggagacagtgtatactcatgacatgaggaagaagaccttccattatatgcttactatt
cctacagcagcatccaatatctccttggccatcggaccattcgaaatacttgtggatcca
tatatgcatgaggttacccatttttgtttgcctcaacttcttccgttacttaaacatact
acgtcatacattcacgaagtttttgaattttatgaagaagttttgacttgccgctatccg
tactcctgttttaagacggtcttcattgatgaggcttacgttgaggtggccgcttacgct
tctatgagtattttcaggttggtgtcccttcagatggagagtgcccaagttaaagtacat
acgaggagaagctctcggctcatcagttttgagactggttttgagcatcatgtatgattg
agttcataggtagtctggtctgatgaatgggtgctgaagggaatttcaggctatatttat
ggactgtggatgaaaaaaacattcggagtcaatgagtaccaccattggattaaagaggag
ctagataaaatagtggcgtatgaactgaaaactgggggagttttacttcatcccatattt
ggtggtggaaaagaaaaggataaccccgcatctcacctccacttttccataaagcatccg
catacactgtcctgggagtactacactatgttccagtgtaaagctcacctcgtgatgaga
ctgatagaaaacagaatcagcatggaatttatgctgcaagttttcaataaactactaagt
ctggccagtactgcttcatcacagaagttccagtcacatatgtggagccagatgctggtt
tccacttacgggtttttgaagtccatttccaatgtctctggcaaagacatccagccctta
ataaagcagtgggtagaccagagtggagtggtaaagttttatggaagttttgcgtttaat
agaaaacgaaatgttttagaactagagataaagcaagattacacatctcctggcacccag
aagtacgtgggacctcttaaagtgacagtgcaagagttagatggatccttcaaccatacc
ttgcaaattgaagaaaacagccttaagcatgacataccctgccactccaaaagcagaagg
aataagaagaaaaaaatcccacttatgaatggggaagaagtcgatatggatctttctgca
atggatgctgattcccctttgttgtggataaggatagacccagatatgtctgtcctgagg
aaggtggagtttgagcaggctgattttatgtggcagtatgagctccgctatgagagagat
gttgttgctcagcaggaatccatcttggccttggaaaacttccccaccccagcgtcgcgc
ctcgcgctcactgatatactagagcaagagcagtgcttctaccgcgtgaggatgtcagcg
tgcttctgcctcgcaaagattgcaaactcaatggtgagcacatggacaggaccaccagcc
atgaagtccctctttactagaatgttttgctgtaaaacttgtcccaacatcgtgaaaaca
aacaacttcatgagtttccagagttattttctgcagaagactatgccggtcgcaatggct
ttgttaagagatgtacataatctttgtcctaaagaagttttaacatttattttagactta
atcaagtacaatgacaacagaaaaaataagttttcagataactattaccgtgcagagatg
attgatgccctggctaattctgttacacctgctgtcagtgtgaataatgaagtcagaact
ttggataacttaaatcctgatgtgcgactaattcttgaagaaataacccggtttctgaat
atggaaaaacttctcccaagttacagacatactataactgtcagttgcttgagagccata
cgggtgcttcagaagaacggacacgtgccaagtgatgcgtctctcttcaaatcctatgct
gagtatggccacttcgtggacatcaggatagcagctctggaagccgtcgttgattacact
aaagtggacaggagttatgaagaacttcagtggctacttaatatgattcagactgaccct
gttccctatgtgaggcataagattctaaacatgttgactaaaaatccgccattcacaaag
aacatggaatctcctttatgcaacgaagccctggtagaccaactctggaagctgatgaat
tctggcactgcacatgactggaggttacggtgtggtgctgtggacttgtacttcacgcta
tttggcctcagcagaccttcttgcttacccttgccagagctcgggcttgttcttaaccta
aaagagaagaaagctgtcttgaatcctaccattattccagaagctggagtaggcaaccag
gagtctgcgagtaacccaggctgccacactcagctagctggattccagaaccccttttca
agttctcaggatgaggaggaggttgatatggatactgttcacgatagtcaagccttcatt
tcccatcatctgaacatgctcgaaaggccgtccactccagggctctctaagtaccgacca
tccggctccagatcctccttaatgccccagcactcattaggctgtgacatcacgccaacc
gcaaagccccagtggagtatggaactgtcccgtaagggagcaggtaaagagcagcctttg
gagatgggtgtgcattccatggtggcagccccgctctccatgtttgctaaggaggctctg
tcgtcccgacacagcgagcaccatcaccaccatcaccatgagcacaagaagaagaagaag
aagcacaagcacaaacacaagcacaagcacaagcacgacggcaaggacaaggacaaggag
cccttcgctttctccagccctgccagcggcaggtctgtgcgctccccctcactctcagac
tga

DBGET integrated database retrieval system