KEGG   Mus pahari (shrew mouse): 110334522Help
Entry
110334522         CDS       T05929                                 

Gene name
Cacna1i
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04020  Calcium signaling pathway
mpah04713  Circadian entrainment
mpah04925  Aldosterone synthesis and secretion
mpah04927  Cortisol synthesis and secretion
mpah04929  GnRH secretion
mpah04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110334522 (Cacna1i)
   04020 Calcium signaling pathway
    110334522 (Cacna1i)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    110334522 (Cacna1i)
   04925 Aldosterone synthesis and secretion
    110334522 (Cacna1i)
   04927 Cortisol synthesis and secretion
    110334522 (Cacna1i)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110334522 (Cacna1i)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110334522 (Cacna1i)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mpah04040]
    110334522 (Cacna1i)
Ion channels [BR:mpah04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110334522 (Cacna1i)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 110334522
NCBI-ProteinID: XP_021071921
Ensembl: MGP_PahariEiJ_G0020041
Position
17
AA seq 2165 aa AA seqDB search
MADSDLPPSSAAVPDPEPGITEQPGPRSPPPSPPGLEEPLDGTNPDIPHPDLAPVAFFCL
RQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMECLSDRCKILQVFDDFI
FIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRV
LRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLE
ENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYD
FGAGRQDLNASGLCVNWNRYYNVCRTGNANPHKGAINFDNIGYAWIVIFQVITLEGWVEI
MYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLSS
STVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQNRRQATGPGTPAPAKPGPHAK
EPSHCKLCPRHSPLDTTPHTLVQPISAILASDPSSCPRCQHEAGRRPSGLGSTDSGQEGS
SSGGSAEAEANGDGPQSSEDGVSSSLGKEEEQEDGAGRLCGDVWRETRAKLRGIVDSKYF
NRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRN
PYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNV
ATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQED
WNVVLYNGMASTTPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSS
SNLEELDKLPEGLDSGRDLKLCPIPMTPNGHLDPSLPLGGHLGPAGAMGAAPRLSLQPDP
MLVALESRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGRSGTWASRRSSWNSLKHKPPSAE
HESLLSGERGGSCVRACEGAREEAPPRAAPLHAPHTHHVHHGPHMAHRHRHHRRTLSLDT
RDSVDLAELVPVVGAHSRAAWRAAGQAPGHEDCNGRMPNIAKDVFTKMDDRRDRGEDEEE
IDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENKLLDLRNGSTERIFLTVSNYIFTA
IFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRV
LRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFY
HCLGVDTRNITNRSDCVAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAV
AVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKR
LRRLEKKRRKAQRLPYYATYCPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPT
SLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEI
NAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIY
AALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTH
DERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELE
MAHGLGPGPGPCPCPCPCPCPCPGPRMPTSSPGASGRGSGGAGVGGDTESHLCRHCYSPA
QETLWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSSPAGCGKCHHDKQEVQLAETEAFS
LNSDRSSSVLLGDDLSLEDPTACPQGPKESKGELEPPEPMQAGDLDECFFPFASEPVSAG
PESLLCEMGAIPFNPVQSWLKHESNQAPPSPFSPDGSSPLLQMPAEFFHPAVSASQKGQE
PGMSAGTLPKIALQGSWASLRSPSVNCTLLRQATVSDTSLDASPSSSAGSLQTTLEDSLT
LSDSPRRALGPPVQVPGPRASLSPATRRRLSLRGRGLFSLRGLRAHQRSHSSGGSTSPGC
THHDSMDPSDEEGRGGAGGGGAGSEHSETLSSLSLTSLFCLPPTLPPPGLTPARKFSSTS
SLTAGPGRPGATVSVRGLVRSPSWAADRSKDPPGQAQLASGLGSSAPEPQPPPGESTDAA
SKRKR
NT seq 6498 nt NT seq  +upstreamnt  +downstreamnt
atggctgacagcgacttaccaccctcatctgcagcagtcccggaccctgagccgggaatc
accgagcagccggggccccggagtccccctccatcccctccaggtctggaggagccactg
gatggaaccaaccctgacatcccgcatccagacctggcacccgttgccttcttctgcctg
cgccagaccacgagcccacggaactggtgcatcaagatggtatgtaacccgtggttcgag
tgtgtgagcatgctggtcatcctgctgaactgcgtgaccctgggcatgtatcagccgtgt
gacgacatggagtgcctctcagaccgctgcaagatcctgcaggtcttcgacgacttcatc
ttcatcttcttcgccatggagatggtgcttaagatggtggccctgggcattttcggcaag
aagtgctacctcggggacacgtggaaccgcctggatttcttcattgtcatggccgggatg
gtcgagtactccctggacctacagaacatcaacctgtcagccatccgcactgtgcgtgtc
ctgaggcctctcaaagccatcaaccgtgttcccagcatgcggattctggttaacctgctg
ctggacacgctgcccatgctgggaaacgtgctcctgctctgtttcttcgtcttcttcatc
ttcggcatcatcggcgtgcaactctgggcaggcctgctgcggaaccgctgcttcctggag
gagaacttcaccatacaaggggacgtggccttgcccccttactaccaaccagaggaggat
gacgagatgccctttatctgctccctgtcgggggacaatggcattatgggctgccacgag
atccctccactcaaggagcagggccgagaatgctgcctgtccaaagatgacgtgtatgac
ttcggggcgggacgccaagacctcaacgccagtggcctctgcgttaactggaaccgctac
tacaacgtctgccgcacgggcaacgccaaccctcacaagggcgccatcaactttgacaac
attggctatgcctggatcgtcatcttccaggtgatcactctggaaggctgggtggagatc
atgtactacgtgatggacgcacactctttctacaacttcatctacttcatcctgctcatc
atagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacccagttctcc
gagaccaagcaacgggagcaccggctgatgctggagcaacgccagcgctacctgtcctcc
agcacagtggccagttacgccgagcccggtgactgctatgaggagatcttccaatatgtc
tgtcacatccttcgcaaggccaagcgccgcgctctgggcctctaccaggccctgcagaac
cggcgtcaggccacgggcccggggacaccagcccctgccaagcctgggccgcatgccaag
gagcccagccactgcaagctgtgcccacgacacagtcccctggacaccactccccataca
ctggtgcagcccatctccgccattctggcctctgaccccagcagctgccctcgctgccag
cacgaggcaggcaggcggccctccggcctgggcagcactgactcaggccaagaaggctcc
agttctggcggctctgcagaggccgaagccaatggcgatggaccccagagcagcgaggac
ggggtctcctcaagcttggggaaggaggaggaacaggaggatggggcaggccgactgtgt
ggggatgtgtggcgagagacacgggccaagctgcggggcatcgtggacagcaagtacttc
aacagaggcatcatgatggctattctggttaacactgtcagcatgggcatcgagcaccat
gaacagcccgaggagctgaccaacatcctggagatctgcaacgtggtcttcaccagcatg
tttgccttggagatgatcctgaagctggctgcctttgggctctttgactacctgcggaac
ccttacaacatcttcgacagcatcattgtcatcatcagcatctgggaaatcgtggggcag
gctgatggcggcctgtccgtgctgcgcaccttccggttgctgcgggtgctgaagctggtg
cgcttcatgccggcgcttcggcgccagctcgtggtgctcatgaagacgatggacaacgtg
gccaccttctgcatgctgctcatgctcttcatcttcatcttcagcatccttgggatgcat
atctttggctgcaaattcagcctccgcacggacactggagacacagtccctgacaggaag
aactttgattccttactgtgggccatcgtcactgtgtttcagatccttactcaggaagac
tggaacgttgtcctgtataatggcatggcctccaccaccccctgggcctccctctatttt
gttgccctcatgacctttggcaactatgttctcttcaatctcctggtggctatcctggtc
gagggcttccaggctgagggtgatgctaaccgctcctactcagatgaggaccagagctca
tccaacttggaggagcttgacaagctcccagagggcctggacagcggcagagatctcaag
ctctgcccgatacccatgacgcccaatggacacctggaccctagcctccctctgggtggg
catctgggtcctgctggtgccatgggtgctgccccccgcctctcactgcagccagaccca
atgctggtggccctagaatcccggaaaagcagtgtcatgtcgctgggcaggatgagctat
gatcagcgatccttgtccagctcccggagctcctactatgggccctggggccgcagtggg
acctgggccagccgccgctccagctggaacagcctgaaacacaagccaccttcagctgag
catgagtccctgctctccggggagcgtggtggtagctgcgtcagggcctgtgaaggcgcc
cgggaggaggcgccacctcgcgctgcacccctgcatgccccgcacacccaccacgtgcac
catggaccccacatggcgcaccgtcaccgccatcaccgccggactctgtccctcgatacc
agggactctgttgacctagcagagctggtgcctgtggtgggtgcccactcgcgggctgct
tggagggcagcgggccaggcccctgggcacgaggactgcaatggcagaatgcccaacata
gccaaggatgtcttcactaagatggacgaccgccgcgaccgtggggaggacgaggaggag
atcgactacaccctgtgtttccgcgtccgcaagatgattgatgtgtacaagcccgactgg
tgcgaagtccgcgaggactggtcggtctacctcttctcccccgagaacaagctgctagat
ctgagaaatggttctacagaacgcattttcctcacggtgtctaactacatcttcacagcc
atcttcgtgggcgagatgacactgaaggtggtctctctgggcctgtacttcggtgagcag
gcttacttgcgtagcagctggaacgtcctggatggtttcctggtctttgtgtccatcatc
gatatcgtggtatccgtggcctctgcggggggagccaagatcctgggggtcctccgcgtc
ctgcggctcctgcgtaccttacgtcctttgagggtcatcagccgggccccagggttgaag
ctggtggtagagacgctcatctcttccctcaagccgatcggaaacatcgtcctcatctgc
tgcgccttcttcatcatctttggcatcctgggggtgcagcttttcaaaggcaagttctat
cactgtctgggagtggacacccgaaacatcaccaaccgatcagactgtgtggccgccaac
taccgctgggtgcatcacaaatacaactttgataacctgggccaggctttgatgtccctc
tttgtcttggcctccaaggatggctgggtgaatatcatgtataatggattggatgctgtt
gctgtggaccagcagccggtgacgaaccacaacccctggatgctgctgtacttcatctcc
ttcctgctcatcgttagcttctttgtgctcaacatgttcgtgggtgtggtcgtggagaac
ttccacaagtgccggcagcaccaggaggctgaggaggcacggaggcgcgaggagaaacgg
ctgcggcgcctggaaaagaagcgccgtaaggctcagaggctgccctactatgccacctac
tgccccacaaggctgctcatccactccatgtgtaccagccactacctggacatcttcatc
accttcatcatctgcctcaatgtggtcaccatgtccctggagcactacaaccagcctaca
tccctagagacagccctcaagtactgcaactacatgttcaccactgtctttgtgctggag
gctgtgctgaagctggtggcgtttggcctgaggcgtttcttcaaggaccgatggaaccag
ctggacctggccattgtgctgctgtctgtcatgggcatcacactggaggagattgagatc
aatgcggccctgcccatcaaccccaccatcatccgtatcatgcgcgttctgcgtattgcc
cgggtgttgaagctgttgaagatggccacgggaatgcgggccctgctggacacggtggta
caggctctgccccaggtgggcaacctaggcctcctcttcatgctgctcttcttcatctac
gctgctctgggagtggagctcttcggaaagctggtctgcaatgacgagaacccgtgtgag
ggcatgagtcggcatgccaccttcgagaacttcggcatggccttcctcacactcttccag
gtctccacaggcgataactggaacgggattatgaaggacactctgcgagactgcacccac
gacgagcgcagctgcctgagcagcctgcagtttgtgtcgcctctctacttcgtgagcttc
gtgctcacggctcagttcgtgctcatcaacgtggtggtggctgtgctgatgaaacatctg
gatgacagcaacaaggaggcccaggaggatgcagagatggatgccgagatcgagctggag
atggcccatggcctagggcctgggcctggcccctgtccctgtccctgtccctgcccctgc
ccctgtcctggcccgaggatgcccaccagctcaccgggggcttcaggccggggatcagga
ggggcaggagttggaggcgacactgagagccacctgtgccggcactgctattctccagcc
caggagaccctgtggctggacagcgtctctttaatcatcaaggactccttggagggggag
ctgaccatcattgacaacctgtctggctccatcttccaccactactcctcacctgctggc
tgtggcaagtgtcaccacgacaagcaagaggtgcagctggctgagacagaggccttctcc
ctgaactcagacaggtcctcgtccgtcctgctgggggatgacctgagtctggaggacccc
acggcctgcccgcagggccccaaggagagcaagggtgagctagagcctccggagcccatg
caggctggggacctggatgaatgctttttcccctttgccagtgagccagtgtctgcaggc
ccagagagcctgctgtgtgagatgggggccattccattcaaccccgtccagtcctggctc
aaacacgagagcaaccaagcacccccgagccctttctccccggatggttccagccctctg
ctgcagatgcctgccgagttcttccaccctgctgtgtcagccagccagaaggggcaggaa
ccgggcatgagtgcagggaccctgcccaagattgcacttcaggggtcctgggcatccctg
aggtcaccgagtgtcaactgcaccctcttgcgccaggctactgtgagtgacacctccttg
gatgccagccctagcagctcagcgggcagcctgcagaccacactggaggacagtttgacc
ctgagtgacagtcctcggcgtgccctgggaccaccggtccaggtgcccgggccacgggct
agcctatcacctgccactcggcgccgcctcagcctgcggggtcgtggcctgtttagtttg
cgtgggctgcgggcccatcagcgtagccacagcagtggtggctccaccagccctggctgc
actcaccatgactccatggacccctctgatgaggagggccgcgggggcgcaggtggcggg
ggcgcgggcagtgagcactccgagaccctcagcagcctgtcactcacatctctcttctgc
ctaccacccacgctgccaccacccggcctcaccccagccaggaagttcagcagtaccagc
agcctgaccgctggacctggccgtcctggcgccactgtctcggtccgtggcctggtcagg
agcccctcctgggctgcagaccgcagcaaggacccaccaggccaggcacagctggcctca
ggcttgggctcctcagcacccgagccacagccacctcccggggagtcaacggatgcggcg
agcaaaaggaagagatga

DBGET integrated database retrieval system