KEGG   Mus pahari (shrew mouse): 110335243Help
Entry
110335243         CDS       T05929                                 

Gene name
A4galt
Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00601  Glycosphingolipid biosynthesis - lacto and neolacto series
mpah00603  Glycosphingolipid biosynthesis - globo and isoglobo series
mpah01100  Metabolic pathways
Module
mpah_M00068  Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    110335243 (A4galt)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    110335243 (A4galt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mpah01003]
    110335243 (A4galt)
Enzymes [BR:mpah01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     110335243 (A4galt)
Glycosyltransferases [BR:mpah01003]
 Glycan extension
  P blood group
   110335243 (A4galt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug
Motif
Other DBs
NCBI-GeneID: 110335243
NCBI-ProteinID: XP_021072981
Ensembl: MGP_PahariEiJ_G0020102
Position
17
AA seq 360 aa AA seqDB search
MGISCSHLEETMSKSPNCLLRMLRGTPRQRVFTLFIISFKFMFLISILIYWHTVDAPKDQ
RQQYSLPVDFSCPQLAFPRVTAPGNIFFLETSDRTSPSFLFMCSVESAARAHPESRVVVL
MKGLPRDTTAQPRNLGISLLSCFPNVWIRPLDLQELFEGTPLAAWYSEAQHRWEPYQLPV
LSDASRIALLWKFGGIYLDTDFIVLKNLRNLTNTLGIQSRYVLNGAFLAFERKHEFLALC
LRDFVANYNGWIWGHQGPQLLTRVFKKWCSIQSLEESHACRGVTALPPEAFYPITWQNWK
KYFEDISPEELTQLLNATYAVHVWNKKSQGTHLEATSKALLAQLHARYCPTTHRAMKMYL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggcatctcctgttcccatctggaggagaccatgtccaagtcccccaactgcctgctg
cggatgctcaggggcacccccagacagcgggtcttcaccctcttcatcatcagcttcaag
ttcatgttcttgatctccatcctgatctactggcacactgtggatgcacccaaggaccag
agacaacagtatagcctgccagtggacttctcctgcccccagctggccttccctagagtc
accgccccaggtaacatcttcttcctggagacatcggacaggaccagtcccagctttcta
tttatgtgttcggtggaatcagctgccagggcacaccctgagtcccgggtggttgtgctc
atgaaagggctgcctagggacaccacagcccagccccggaaccttggcatctctcttctg
agctgctttcccaatgtctggatacggcctctagatctgcaagaactgtttgagggcaca
ccactggcagcctggtactcggaggcacagcacaggtgggagccctaccagttacccgta
ctgtctgatgcttccaggatcgcgctcctctggaagttcggtgggatctacctggacacg
gacttcatcgtcctcaagaacctgcgcaacctgaccaacacgctgggcatccaatcccgc
tacgtcctcaacggtgccttcctagccttcgagcgcaagcatgagttcttggcactgtgt
ctgcgtgactttgtggccaactacaatggttggatttggggtcaccagggcccccaactg
cttacccgagtcttcaagaagtggtgttccatccaaagcctggaagagagccatgcttgc
cgtggggtcactgccctgccccctgaggccttctaccccatcacctggcagaactggaag
aaatactttgaagacatcagccccgaggagctgacccagctgctcaatgccacctatgct
gttcatgtgtggaacaagaaaagtcagggtacacacctagaggccacatccaaggctctg
ctggcccagctacatgcccgctattgccctacgacacatagagccatgaagatgtacttg
tga

DBGET integrated database retrieval system