KEGG   Mus pahari (shrew mouse): 110335695Help
Entry
110335695         CDS       T05929                                 

Gene name
Hspa1l
Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03040  Spliceosome
mpah04010  MAPK signaling pathway
mpah04141  Protein processing in endoplasmic reticulum
mpah04144  Endocytosis
mpah04213  Longevity regulating pathway - multiple species
mpah04612  Antigen processing and presentation
mpah04915  Estrogen signaling pathway
mpah05134  Legionellosis
mpah05145  Toxoplasmosis
mpah05162  Measles
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110335695 (Hspa1l)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110335695 (Hspa1l)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110335695 (Hspa1l)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110335695 (Hspa1l)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110335695 (Hspa1l)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110335695 (Hspa1l)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110335695 (Hspa1l)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110335695 (Hspa1l)
  09172 Infectious disease: viral
   05162 Measles
    110335695 (Hspa1l)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110335695 (Hspa1l)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110335695 (Hspa1l)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mpah03041]
    110335695 (Hspa1l)
   03009 Ribosome biogenesis [BR:mpah03009]
    110335695 (Hspa1l)
   03110 Chaperones and folding catalysts [BR:mpah03110]
    110335695 (Hspa1l)
   04131 Membrane trafficking [BR:mpah04131]
    110335695 (Hspa1l)
   03051 Proteasome [BR:mpah03051]
    110335695 (Hspa1l)
   03029 Mitochondrial biogenesis [BR:mpah03029]
    110335695 (Hspa1l)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335695 (Hspa1l)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110335695 (Hspa1l)
Spliceosome [BR:mpah03041]
 Complex B
  Other components
   Prp19 complex
    110335695 (Hspa1l)
 Complex C
   Prp19-CDC5 complex
    110335695 (Hspa1l)
Ribosome biogenesis [BR:mpah03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110335695 (Hspa1l)
Chaperones and folding catalysts [BR:mpah03110]
 Heat shock proteins
  HSP70 / DNAK
   110335695 (Hspa1l)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110335695 (Hspa1l)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110335695 (Hspa1l)
Proteasome [BR:mpah03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110335695 (Hspa1l)
Mitochondrial biogenesis [BR:mpah03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110335695 (Hspa1l)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110335695 (Hspa1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Radial_spoke_3 FGGY_C DUF1464
Motif
Other DBs
NCBI-GeneID: 110335695
NCBI-ProteinID: XP_021073659
Ensembl: MGP_PahariEiJ_G0020484
Position
18
AA seq 641 aa AA seqDB search
MATNKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVMVSYKGEKKAFYPEE
ISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSIT
RARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNS
TIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAA
KNALESYAFNMKSAVGDEGLKDKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKE
LENMCNPIITKLYQSGCTGPTCAPGYTPGRAATGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctactaataaaggaatggcgatcggcatcgacctgggcaccacctactcgtgtgtg
ggcgtgttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacc
cccagctatgtggccttcaccgacaccgagcgcctcatcggcgacgctgccaagaaccag
gtggccatgaatccccaaaacactgtttttgatgccaaacgtctaattggcaggaagttt
aatgatcctgttgtgcagtcagatatgaagctttggccatttcaagtgatcaatgaagca
ggcaagcccaaggtgatggtgtcctataaaggagagaagaaagccttctacccagaggag
atctcatccatggtactgacgaagatgaaggagactgcagaggcttttttgggccacaat
gtcacgaacgctgtgatcacggtgccagcctatttcaatgactctcagcggcaggccacc
aaggatgcaggtgtcatcgcaggactcaatgtgctgagaataatcaatgagcccacagcg
gccgccattgcctacggcttggataaagggagtcacggagagcggcacgtgctcatcttt
gacctggggggcggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgag
gtgaaggccacggcgggcgacacgcacctgggcggggaggacttcgacaaccggctggtg
agccacttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgc
gcggtgcggcggctgcgcacagcgtgcgagagggccaagaggacactgtcgtccagcacc
caggccagcctggagatcgactccctgttcgagggcatcgacttctacacgtccatcact
agagcacggtttgaagagctgtgtgcagacctatttagaggcacacttgagcctgtggaa
aagtctcttcgggatgccaagatggacaaggctaaaatccatgacattgttctagtaggg
ggctctacccgcatcccaaaggtgcaaaaactgcttcaggactactttaatggacgggat
ctcaacaagagtatcaatcccgatgaggcggtcgcctacggagctgccgtccaggcagct
attttaatgggcgacaaatctgaaaaagtacaggatttgcttttgttggacgtagctccc
ctgtctctaggattggagacagctgggggtgtgatgactgtactgatcaagcgcaactcc
accatccccaccaagcagacgcagaccttcaccacctactcggacaaccagcccggggtg
ctgatccaggtgtacgagggcgagagggccatgacgcgcgacaacaacctgctggggcgc
ttcgagctgagcggcatcccgccggcgcccaggggcgtgccgcagatcgaggtgaccttc
gacatcgatgccaatggcatcctgaacgtcacggccatggacaagagcaccggcaaggcc
aacaagatcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatg
gtgcaggaggccgagcgctacaaagcggaggatgagggccagagggagaaaatcgctgcc
aaaaatgccttagaatcgtacgcctttaacatgaagagcgctgtgggtgatgagggtctg
aaggacaagatcagcgagtccgataaaaagaaaatactggataaatgcaatgaggtcctt
tcctggctggaggccaaccagctggctgagaaagatgagtttgatcataaaagaaaagaa
ctggaaaatatgtgtaacccgatcatcacaaaactgtaccagagcggatgcaccgggccc
acctgtgcaccagggtatactcccggcagggctgccacaggccccaccatcgaggaagta
gattag

DBGET integrated database retrieval system