KEGG   Mus pahari (shrew mouse): 110336233Help
Entry
110336233         CDS       T05929                                 

Gene name
Erlin2
Definition
(RefSeq) erlin-2
  KO
K23341  erlin
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110336233 (Erlin2)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    110336233 (Erlin2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346 DUF2083 POR_N
Motif
Other DBs
NCBI-GeneID: 110336233
NCBI-ProteinID: XP_021074351
Ensembl: MGP_PahariEiJ_G0021411
Position
19
AA seq 323 aa AA seqDB search
MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK
SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI
HHELNQFCSVHTLQEVYIELFVVICPLLQAVRVTKPNIPEAIRRNYELMESEKTKLLIAA
QKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAK
ADAECYTALKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGGLGKQFE
GLSDDKLGFGLEDEPLEAPTKEN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttgggagctgttgtggccgtggcttccagtttcttttgcgcatctctcttc
tcggctgtgcacaagatagaagaggggcatattggcgtatattacagaggtggtgccctg
ctgacgtccaccagtggcccgggtttccatctcatgcttccattcatcacgtcctacaag
tctgtacagaccactctccaaactgatgaagtgaagaacgtaccatgtggaaccagtggt
ggtgtgatgatctactttgacagaattgaagtggtgaacttcctggtcccaaatgcagtg
tatgatatagtgaagaactatactgcagactacgacaaggccctcatcttcaacaagatc
catcatgagcttaaccagttctgcagtgttcatacacttcaggaagtctatatcgagctg
tttgttgttatttgtccccttctccaggctgtacgagtgacaaagcccaatatacctgag
gcaatccgcaggaactatgagctgatggaaagcgagaagacgaagcttctcattgcagcc
cagaagcagaaggtggtggaaaaggaggcagaaacagagaggaagaaggccctcattgag
gcagaaaaagtggcacaggttgcagaaatcacctatgggcaaaaggtgatggagaaggag
acagagaagaagatctcagaaatcgaagatgctgcgttcctggcccgggagaaggcgaag
gctgatgctgagtgctacacggcgctgaagattgcagaagcaaataagctcaagctgact
ccggagtatctgcagctgatgaagtacaaggccattgcttccaacagcaagatttacttc
ggcaaagacatccccaacatgtttatggattccgcaggggggctgggcaagcagtttgag
gggctgagcgacgacaagctgggctttggcctagaagatgagcccctcgaggcacccaca
aaggagaactga

DBGET integrated database retrieval system