KEGG   Mus pahari (shrew mouse): 110336987Help
Entry
110336987         CDS       T05929                                 

Definition
(RefSeq) arylamine N-acetyltransferase 1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00232  Caffeine metabolism
mpah00983  Drug metabolism - other enzymes
mpah01100  Metabolic pathways
mpah05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    110336987
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110336987
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110336987
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     110336987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 110336987
NCBI-ProteinID: XP_021075390
Ensembl: MGP_PahariEiJ_G0021564
Position
19
AA seq 290 aa AA seqDB search
MDIEAYFERIGYKNSVNKLDLATLTEVLQHQMRAVPFENLNMHCGEAMHLDLEAIFDHIV
RKKRGGWCLQVNHLLYWALTKMGFETAMLGGYVYITPVSKYSSEMVHLLVQVTISDRKYI
VDSAYGGSYQMWEPLELASGKDQPQVPAIFLLTEENGTWYLDQIRREQYVPNEEFVNSDL
LEKNKYRKIYSFTLEPRVIEDFEYVNSYLQTSPASVFVSTSFCSLQTSEGVCCLVGSTFT
SRRFSYKDDVDLVEFKNVNEEEIEDVLKTAFGISLERKFVPKHGELVFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgaagcatactttgaaaggattggttacaagaactcagtgaataaattggac
ttagccacattaactgaagttcttcagcaccagatgcgagcagttcctttcgagaatctt
aacatgcattgtggagaagccatgcatctggacttagaggccatttttgaccacatagta
aggaagaagagaggtggatggtgtctccaggttaatcatctgctgtactgggctctgacc
aaaatgggctttgaaaccgcaatgttgggaggatatgtttacataactccagtcagcaaa
tatagcagtgaaatggtccaccttctagtacaggtgaccatcagtgacaggaagtacatt
gtggattccgcttatggaggctcctatcagatgtgggagcctctggaattagcatctggg
aaggatcagcctcaggtgcctgccatttttcttttgacagaggagaatggaacctggtac
ttggaccaaatcagaagagagcagtatgttccaaatgaagaatttgttaactcagacctc
cttgaaaagaacaaatatcgaaaaatctattcctttactcttgagccccgagttatcgag
gatttcgaatatgtgaatagctaccttcagacatcgccagcatctgtatttgtaagcaca
tcgttctgttccttgcagacctcagaaggggtttgctgtttagtgggctccacctttaca
agtaggagattcagttataaggacgatgtagatctggttgagtttaagaatgtgaatgag
gaagaaatagaagacgtactgaaaaccgcatttggcatttctttggagagaaagtttgtg
cccaaacatggtgaactagtttttactatttag

DBGET integrated database retrieval system