KEGG   Mus pahari (shrew mouse): 110338000Help
Entry
110338000         CDS       T05929                                 

Gene name
Nme3
Definition
(RefSeq) nucleoside diphosphate kinase 3 isoform X1
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00230  Purine metabolism
mpah00240  Pyrimidine metabolism
mpah00983  Drug metabolism - other enzymes
mpah01100  Metabolic pathways
Module
mpah_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mpah_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mpah_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110338000 (Nme3)
   00240 Pyrimidine metabolism
    110338000 (Nme3)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110338000 (Nme3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110338000 (Nme3)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     110338000 (Nme3)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    110338000 (Nme3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK PSI_PsaJ Amidohydro_2 Peptidase_S77
Motif
Other DBs
NCBI-GeneID: 110338000
NCBI-ProteinID: XP_021076799
Ensembl: MGP_PahariEiJ_G0023532
Position
21
AA seq 169 aa AA seqDB search
MICLVLTIFANLFPSAYSGVNERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQA
SEELLREHYVELRERPFYSRLVKYMSSGPVVAMVWQGLDVVRASRALIGATDPGDAMPGT
IRGDFCVEVGKNVIHGSDSVESAHREIALWFREDELLCWEDSAGHWLYE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtctggtgctgaccatcttcgctaatctcttcccctccgcctacagcggcgtg
aacgaacgcacgttcttggcagtgaagcccgacggcgtgcagcggaggctggtgggcgag
atcgtgcgtcgctttgagaggaagggcttcaagctggtggcactgaagctagtgcaggcc
tccgaagagctactgcgggagcattatgtcgagctgcgcgagagacccttctacagccga
ctagttaaatacatgagttctggccccgtggtggccatggtgtggcaagggttggatgtc
gtgcgtgcttcgcgagccctcataggggccactgacccaggggacgccatgcccggtacg
atccgtggggacttctgcgtggaggttggcaagaatgtcattcatggcagtgattcggtg
gaaagcgctcacagagaaatcgctctttggttccgggaggatgagcttttgtgctgggag
gacagcgccggacactggctgtatgagtag

DBGET integrated database retrieval system