KEGG   Mus pahari (shrew mouse): 110338032
Entry
110338032         CDS       T05929                                 

Gene name
Lnpep
Definition
(RefSeq) leucyl-cystinyl aminopeptidase
  KO
K01257  cystinyl aminopeptidase [EC:3.4.11.3]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    110338032 (Lnpep)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110338032 (Lnpep)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.3  cystinyl aminopeptidase
     110338032 (Lnpep)
Peptidases and inhibitors [BR:mpah01002]
 Metallo peptidases
  Family M1
   110338032 (Lnpep)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF5011 pP_pnuc_1 Dynactin
Other DBs
NCBI-GeneID: 110338032
NCBI-ProteinID: XP_021076861
Ensembl: MGP_PahariEiJ_G0023417
Position
21
AA seq 1011 aa
MIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGEHEMDEDEEDYESSA
KLLGMSFMNRSSGLRNSAAGYRQSPDGTCSVPSARTLVICVFVIVVAVSVIMVIYLLPRC
TFTKEGCHKTNQSAELIQPVATNGKVFPWAQIRLPTAIIPQCYELSLHPNLTSMTFRGSV
TISLQALQDTRNIILHSTGHNISRVTFMSAVSSQEKQVEILEYPYHEQIAVVAPEPLLTG
HNYTLKIEYSANISNSYYGFYGITYTDKSNEKKYFAATQFEPLAARSAFPCFDEPAFKAT
FIIKITRNEHHTALSNMPKKSSVPAEEGLIEDEFSESVKMSTYLVAFIVGEMRNLSQDVN
GTLVSVYAVPEKIGQVHHALDTTIKLLEFYQNYFEIQYPLKKLDLVAIPDFEAGAMENWG
LLTFREETLLYDNATSSVADRKLVTKIIAHELAHQWFGNLVTMQWWNDLWLNEGFATFME
YFSVEKIFKELNSYEDFLDARFKTMRKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGAS
LLLMLKSYLSEDVFRHAVILYLHNHSYAAIQSDDLWDSFNEVTDKTLDVKKMMKTWTLQK
GFPLVTVQRKGTELLLQQERFFLSMQPEIQASDTSHLWHIPISYVTDGRDYAEHRSVSLL
DKKSDVINLTEQVQWVKVNSNMTGYYIVHYAHDDWTALINQLKRNPYVLSDKDRANLINN
IFELAGLGKVPLRMAFDLIDYLKNETHTAPITEALLQTNLIYNLLEKLGHMDLSSRLVAR
VHKLLQNQIQQQTWTDEGTPSMRELRSALLEFACAHSLENCTTMATNLFDNWMASNGTQS
LPTDIMITVFKVGARTEKGWLFLFSMYSSMGSEAEKNKILEALASSEDVHKLYWLMKSSL
DGDIIRTQKLSLIIRAVGRHFPGHLLAWDFVKENWNKLVHKFHLGSYTIQSIVAGSTHLF
STKTHLSEVQAFFENQSEATLKLRCVQEALEVIQLNIQWMARNLKTLSQWL
NT seq 3036 nt   +upstreamnt  +downstreamnt
atgattgaaaacagcatgtttgaagaagaaccagatgtggtagatttagccaaagaacct
tgtttacatcctttggaacctgatgaagttgaatatgagccccgaggttcgaggctcctg
gtgcgcggtcttggtgagcatgagatggatgaggatgaagaagattatgagtcatctgca
aagctgctgggcatgtccttcatgaacagaagctcaggccttcggaacagtgcggcaggc
tacaggcagagtccagatgggacttgttcagtaccctctgccaggactttagtgatctgt
gtttttgtcattgtggttgcggtctctgtaatcatggtgatttatctactgcctagatgt
acctttaccaaagaaggctgccacaaaacaaaccagtcagcggaactcattcagccagtt
gctacaaatgggaaagtgttcccatgggctcaaattaggcttcccactgccattattcct
caatgctatgaacttagcctacatccaaacctaacctcaatgacattcaggggttctgtg
acaatttcacttcaggctcttcaagacacacggaatatcattctccatagcacaggacat
aatatttcaagagtgacatttatgtcagcagtttcaagtcaagaaaaacaagttgaaatt
ctggaatatccatatcatgaacaaatcgccgttgttgcccctgaacctcttctgacagga
cacaattataccctgaagatagagtattcagcaaatatatctaactcttattatgggttt
tatggcatcacctacacagataaaagtaatgagaaaaagtactttgcagcaactcagttt
gaacctctggcagcaagatctgcttttccttgttttgatgaaccagcatttaaggccaca
tttatcatcaagatcacaaggaatgagcaccatactgcgttatcaaatatgcctaagaag
tcatcggtccctgcagaagaaggacttattgaagatgagttttctgaaagtgtgaaaatg
agcacatacctggttgctttcattgtaggggagatgaggaacctgagtcaggatgtaaat
ggaactctggtttctgtgtacgctgtaccagaaaaaattggtcaagttcaccatgccttg
gacacaactataaagctccttgagttttatcaaaattactttgaaattcagtacccactt
aagaaattggatttggtggccattcctgactttgaagcaggagcaatggaaaactggggc
ctgcttacattccgagaagagactcttctgtatgacaatgcaacttcttcagtagcagat
agaaaactggtcactaaaatcattgctcacgaactggcacatcagtggtttggtaatctg
gttacaatgcagtggtggaatgacctgtggctaaatgaaggctttgccactttcatggag
tatttctctgtggaaaaaatattcaaagagctcaacagttatgaagatttcttagatgct
cgatttaaaaccatgaggaaagattccttgaattcgtctcatccaatatcatcatctgtt
cagtcttcagaacaaatagaagaaatgtttgattctctttcctactttaagggagcttct
ctcttgttgatgctgaaaagttaccttagtgaagatgtatttcggcatgctgtcattctt
tacctgcacaatcacagctatgcagctattcaaagcgatgatctctgggacagcttcaat
gaggtcacagacaaaactctagatgtaaagaaaatgatgaaaacctggaccctacagaaa
ggattcccattagtgacagtccagaggaaggggactgagcttcttctacaacaagaaaga
ttttttctaagcatgcaaccagaaattcaggcttcagacacaagccacctctggcatatt
ccaatatcctatgtcactgatggaagagactatgcagaacatcggtcagtttcactactg
gacaagaaatcagatgtcatcaatcttacagaacaagtgcagtgggtcaaagtcaattca
aacatgactggctattacattgttcactatgctcatgatgactggacagctctaatcaat
cagttaaaaagaaatccttatgttctgagtgacaaagaccgagccaacctgatcaataac
atctttgaacttgcaggccttggcaaagtgcctcttcgaatggcatttgatttgattgac
tatcttaaaaatgagacacacactgcacccatcactgaagccctgctccagacaaacctt
atctataatctcctagaaaaactggggcacatggacctgtcctcccgattggtggccaga
gtacataaattgctccagaaccaaatccagcagcagacttggacggatgaaggcacacca
tccatgcgagagcttcggtcagccttgctggaatttgcctgtgcccacagcctagagaac
tgtaccactatggcaacaaacctgtttgacaattggatggcatcaaatggaactcagagc
ctgcctactgatatcatgatcactgtgttcaaagtgggagcgagaaccgagaaaggctgg
ttgttcctctttagcatgtattcctccatgggctctgaagcagaaaagaataaaatactt
gaagctcttgccagctcagaggatgtacataaactttactggttaatgaaaagtagcctt
gatggtgatatcatccggacacagaagttgtcacttatcattagagcagtgggcagacat
ttccctggacacttgctggcttgggattttgttaaagaaaactggaataagcttgtacat
aagttccatctgggctcctataccatacaaagtattgttgctggatctactcacttattt
tcaacaaagacacatttatctgaggtccaggcattctttgaaaatcagtcagaggcaacc
ttgaagcttcggtgtgttcaggaggctttggaagtgattcagctgaatatccagtggatg
gccaggaatctgaaaacgctgtcacagtggctgtag

DBGET integrated database retrieval system