KEGG   Mus pahari (shrew mouse): 110338973Help
Entry
110338973         CDS       T05929                                 

Gene name
Gba2
Definition
(RefSeq) non-lysosomal glucosylceramidase
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00511  Other glycan degradation
mpah00600  Sphingolipid metabolism
mpah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    110338973 (Gba2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    110338973 (Gba2)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     110338973 (Gba2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H DUF5127
Motif
Other DBs
NCBI-GeneID: 110338973
NCBI-ProteinID: XP_021078103
Ensembl: MGP_PahariEiJ_G0024088
Position
22
AA seq 918 aa AA seqDB search
MVTCVPASEQIGCAERDSHVYCEDTGGTEAVRVTDCGSPEDSEPQNEPSHCNSEDSGQLM
ASYEGKARGYQVPPFGWRICLAHEFAEKRKPFQANNISLSNLVKHFGMGLRYLKWWYRKT
HVEKKTPFIDMFNSVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHQTVIADQ
FIVCLRRDGRTVYQQVLSLELPSVLRSWNWGLCGYFAFYHALYPRAWTVYQLPGQNVTLT
CRQITPILPHDYQDSSLPVGVFVWDVENGGDETLDVSITFSMRNGLGGEDDAAGGLWNEP
FRLEQDGTTVQGLLLHHPTPPNPYTMAVAARCTADTTVTYTTAFDPDGTGQQVWQDLLQD
GQLDSPAGQSTPTQKGEGIAGAVCISSKLLPRSRCCLEFSLAWDMPRIMFGAKGQVHYRR
YTRFFGSDGDVAPALSHYALCQYADWENRISAWQNPILDDRTLPAWYKSALFNELYFLAD
GGTVWLEVPADSLPEGLGGTMHQLRSTLQDYGRFGYLEGQEYRMYNTYDVHFYASFALVM
LWPKLELSLQYDMALATFKEDLTRRRYLMSGVVAPVKRRNVIPHDIGDPDDEPWLRVNAY
LIHDTADWKDLNLKFVLQVYRDYYLTGDQGFLKDMWPVCLAVMESEMKFDKDQDGLIENG
GYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAVLCGAQDVQERFASILCRGREAYERL
LWNGRYYNYDSSSQPQSRSVMSDQCAGQWFLRACGLGEGDTEVFPTLHVVRALQTIFELN
VQAFAGGAMGAVNGMQPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFRTAEGCY
RTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQHKKSRRPAVTQITGL
STQPECGPKRSLANLSPE
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggtaacctgcgtcccagcctccgagcagatcggctgtgccgaaagagattcccacgtt
tattgtgaagatactggaggtactgaggctgtgcgggttacagactgcgggagccccgag
gacagtgaaccccagaatgagccaagccactgcaattcagaggactctgggcagctgatg
gcctcctacgagggtaaagctaggggctaccaggtgcctccttttggctggcggatctgc
ttggctcacgagtttgcagagaagagaaaaccttttcaggctaacaacatctctctcagt
aatttggtaaagcacttcggtatgggcttgaggtacttgaagtggtggtaccggaagacc
cacgtggaaaagaagacccctttcatcgacatgttcaattctgtacccctgagacagatc
tatggttgtcccctgggtggcattggaggaggcactatcacccggggctggagaggccag
ttctgtcgttggcagctcaaccctggaatgtaccagcaccagacagtcattgcagaccaa
tttatagtatgcttgcgtcgagatgggcggactgtgtaccagcaagttctgtccttggag
cttccgagtgtcctgcgcagctggaactggggcctgtgtggctactttgctttctaccac
gccctctatccccgcgcctggacggtctatcagcttcctggccagaatgtcaccctcacc
tgtcgccagatcacacctatcttgcctcatgactaccaggacagcagtctccctgtaggc
gtctttgtgtgggatgtagaaaacggaggagacgagaccctggatgtgtccatcacattc
tccatgcggaatggactaggaggtgaagatgatgcggctggaggtttgtggaatgagccc
ttccgcctggagcaggatgggacgactgtacaggggctactcctgcatcatccaacccct
ccgaacccctacaccatggctgtggctgcacgatgcacggcagataccacggtaacctac
accacagcatttgaccccgacggcactgggcagcaggtgtggcaggacctacttcaggat
ggacagctggactcccctgctggccaaagcaccccgacacagaaaggagagggtatcgct
ggggctgtgtgcatctccagcaagctgctacctcgaagccggtgctgcttggagttctca
ctggcttgggatatgcctaggatcatgtttggagctaaaggacaagtccactacaggcgg
tatacacggttctttggttcagatggtgatgtggcacctgccctgagccactatgcactg
tgccaatatgcagactgggagaacagaatctcagcatggcagaacccaatactggatgac
agaaccttgcctgcctggtacaaatctgcactgttcaatgaactgtatttcctggccgat
ggaggcacggtgtggctggaagttcctgcagactccctaccagaggggctgggagggacc
atgcatcagcttcgctcgactctgcaggactatgggcgatttggctaccttgaaggccag
gagtaccgcatgtacaacacgtacgacgtccacttttatgcttcctttgccctcgtcatg
ctgtggcctaaactcgagctcagtctccagtatgatatggctctggcaactttcaaggag
gacctgacccggcgacggtacctgatgagtggagtggtggcacctgtgaaaaggaggaat
gtcatccctcatgacattggggatccagatgatgagccatggctccgggtcaacgcatat
ttgattcatgatactgctgattggaaggacctgaacctgaagtttgtgttgcaagtttat
cgggactactacctgacgggtgatcaaggcttcctgaaggacatgtggcctgtatgtctg
gctgtgatggagtccgaaatgaagtttgataaggaccaagatggactcattgagaatgga
ggctacgcagaccagacctatgatggatgggtcaccacaggccccagtgcttactgcgga
gggctgtggctggcagcagtggctgtaatggttcagatggccgttctgtgtggggcccag
gatgtccaggagaggtttgcttccattctctgccgaggccgagaagcttatgagagactg
ctctggaatggacgctattacaactacgacagcagctcccagcctcagtcccgcagcgtc
atgtctgaccagtgtgctgggcagtggttcctgagggcctgcggcctgggagaaggagac
actgaagtatttcctaccctgcatgtggtccgtgctctccaaaccatctttgaactcaat
gtccaagcctttgcaggaggagccatgggggctgtgaatgggatgcagcctcatggtgtc
cctgatagatccagtgtgcagtctgatgaagtctgggtgggtgtggtctatgggctggca
gccaccatgatccaagagggcctgacttgggaaggtttccggacagctgaaggctgttac
cgcactgtatgggaacgcctgggcctggctttccagaccccagaggcatactgccagcaa
cgagtgttccgctccctggcctacatgcggccactgagcatctgggccatgcagctggcc
ctgcaacagcagcagcataaaaagagccgcaggccagcagtcacccaaatcacgggacta
agtacacagcctgaatgtggaccaaagagatcgctggcaaacctcagtccagagtga

DBGET integrated database retrieval system