KEGG   Microbacterium paludicola: BO218_03055Help
Entry
BO218_03055       CDS       T04601                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mpal  Microbacterium paludicola
Pathway
mpal00230  Purine metabolism
mpal00240  Pyrimidine metabolism
mpal01100  Metabolic pathways
mpal01110  Biosynthesis of secondary metabolites
Module
mpal_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mpal_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mpal_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mpal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BO218_03055
   00240 Pyrimidine metabolism
    BO218_03055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpal04131]
    BO218_03055
Enzymes [BR:mpal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BO218_03055
Membrane trafficking [BR:mpal04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BO218_03055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: APF33306
Position
complement(651430..651846)
Genome map
AA seq 138 aa AA seqDB search
MPTEETLVLVKPDGVARGLTGAILARIEAKGYALVDIRLVEADRELLEQHYAEHAGKPFY
EPLLEFMQSGPSVAIRLAGNRVIEGFRSLAGTTDPTTAAPGTIRGDFGRDWGLAVQQNLV
HGSDSPESAARELQIWFG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgaagagaccctcgttctcgtcaagcccgacggcgtggctcgcggcctcacc
ggcgcgatcctggctcgtatcgaagccaagggatacgcgctcgtcgacatccgtctggtc
gaggccgaccgtgagctgctcgagcagcactacgccgagcacgcgggcaagccgttctac
gagccgctgctcgagttcatgcagagcggaccgtcggtggccatccgcctcgccggcaat
cgtgtcatcgagggcttccggtccctcgccgggaccaccgatccgacgacggcggccccc
ggaacgatccgcggcgacttcggtcgcgactggggcctggctgttcagcagaacctcgtc
cacggttccgacagccccgagtccgcagcccgcgagctgcagatctggttcggctga

DBGET integrated database retrieval system