KEGG   Microbacterium paludicola: BO218_03840Help
Entry
BO218_03840       CDS       T04601                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mpal  Microbacterium paludicola
Pathway
mpal00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mpal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BO218_03840
Enzymes [BR:mpal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BO218_03840
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BO218_03840
    1.1.1.-  
     BO218_03840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: APF33442
Position
complement(804403..805455)
Genome map
AA seq 350 aa AA seqDB search
MKAAVFHAKEDLRVENVDEPAVSAGQVKLKNAFAGICGSDLHVYYAPEAAGLTLDEPHPV
TGAQLPQILGHEFAGTVVEVGDGVEGVSVGDRAAVWPVYYCGECPACEKGMFNACQNIGF
HGLSSHGGGMAEYTTVPASMLHKLPENVDLRMGALVEPMAVAWHAVERSFVKAGQTAIVA
GAGPIGIGVWFALKAHGVERVLVSEPSASRRETIAALGATVVDPVSGDLAAAVAELTGGR
GADVAFDAAGAGPAITSGLASLVPGGRLVVVAIHERAMEFSPTQLVMAETEIAGALAYLP
ADFDAVIDAMSRGVYDTTGWVEEVPIDGVVGAIEKLRGGAGAKILVRADA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcagtgttccacgcgaaggaagacctccgtgtggagaacgtcgacgaaccc
gcggtgagcgcaggccaggtgaagctgaagaacgctttcgcgggcatctgcgggtcggat
ctgcacgtctattacgctccggaagccgcgggcctcacgctcgacgagccgcacccggtg
accggtgcgcagcttccgcagatcctcggccacgagttcgcgggaaccgtcgtcgaggtc
ggcgacggggtcgagggggtctcggtcggcgatcgtgccgcagtctggcccgtctactac
tgcggcgagtgccccgcgtgcgagaagggcatgttcaacgcctgccagaacatcggcttc
cacggactcagctcgcacggcggcgggatggcggagtacacgacggttccggcctcgatg
ctgcacaagctccccgagaacgtcgacctgcgcatgggcgccctcgtcgagcccatggcc
gtcgcgtggcacgcggtcgagcgctccttcgtgaaagcgggacagaccgcaatcgtcgcg
ggcgccggccccatcggcatcggcgtctggttcgctctcaaggcgcacggcgtcgagagg
gtcctcgtgtcggagcccagcgcatcgcggcgtgagacgatcgccgcgctcggtgcgacg
gtcgtcgaccccgtgtcgggcgacctcgccgccgctgtggccgagctcacgggcggacga
ggtgccgacgtcgcgttcgatgccgccggcgccggaccggctatcacgtcgggactcgcg
agcctcgtgcccggcgggcgcctcgtcgtcgtggcgatccacgagcgcgcgatggagttc
tcgccgacgcaactggtcatggccgagaccgagatcgccggtgcgctggcgtaccttccg
gccgacttcgacgccgtcatcgacgcgatgtcgcgcggcgtctacgacacgacgggatgg
gtcgaggaggtcccgatcgacggtgtggtcggcgccatcgagaagctccgcggtggggcc
ggggcgaagatcctggtgcgcgcggacgcctga

DBGET integrated database retrieval system