KEGG   Mycoplasma pneumoniae M129-B7: C985_0654Help
Entry
C985_0654         CDS       T02596                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mpb  Mycoplasma pneumoniae M129-B7
Pathway
mpb00051  Fructose and mannose metabolism
mpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C985_0654
Enzymes [BR:mpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     C985_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh Mannitol_dh_C AHD Sacchrp_dh_NADP B12-binding
Motif
Other DBs
NCBI-ProteinID: AGC04519
Position
777520..778614
Genome map
AA seq 364 aa AA seqDB search
MKRINVLHFGAGNIGRGVILPIYQQNDFSIDLVELNQNTVNELQKQKQYQVHYLDCDQSQ
LVNDFNTWNLKDEAKIIELMERADVISTSIGAKNLASLKTLFDKAKFHKRAIVLCFENGF
RISSNFKNILQLNNTQVNFVDVVIDTIAPNFEKKANFLDIYCEKYSEIYAETFPLEIKGV
NQKNSLDRFIIKKLLLVNALHSVIGLLGFQQKLKYVHETLQVKSNLTFVEKLAQQIIDAL
CAEYPEFNKNNLLSYGKNNLVRFANPKIQDLNTRLIREPLRKLNQNERFYAIYKLFKKNK
IALNNILQVYLMVLKTNITDDTESQQIAKLINEKAWTELAKLSSLEESEWNLIKQELSRE
ITKK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattaatgtattgcactttggcgctggtaatataggtagaggtgttatatta
ccgatttaccaacaaaatgacttttccattgatttagtggaattgaatcaaaatacagtt
aatgagttacaaaagcaaaaacaataccaagttcattaccttgattgtgatcaaagtcag
ttagttaatgactttaatacttgaaacttaaaggatgaagcgaagattattgaactaatg
gaaagagctgatgttatttccacttcaataggtgctaaaaacttagctagtttaaaaact
ttgtttgacaaagctaagttccataaaagggctatagtgctttgctttgaaaacggcttt
cggattagttctaactttaaaaacattttgcaattaaataacacacaagtaaattttgtg
gatgtggtaatcgatacaattgcacctaacttcgaaaagaaagcgaatttcttggatatt
tattgcgagaagtattcagaaatttatgctgaaactttcccgctagaaattaagggagta
aatcaaaagaatagtttagatagattcattattaaaaaacttttattagtcaatgcactg
cacagtgttattggacttttaggctttcaacaaaagcttaagtatgtacatgaaacattg
caagttaaaagtaatttgacttttgtagaaaaattagcccaacaaattattgatgccctt
tgtgctgaatatcctgaatttaataaaaataatttgttaagttatggcaaaaataactta
gtccgttttgctaatcccaagattcaagatttaaacacacgcttaattagggaaccatta
cgtaaacttaaccaaaatgaacgcttttatgccatttataaactctttaaaaagaataag
attgcactaaataatattttgcaagtttatctgatggttttaaaaactaatataacagat
gataccgaaagccaacaaattgctaaattaataaatgaaaaagcttgaacagagttagcg
aaattatccagtttagaagagtcagaatgaaacctaattaaacaagaattaagccgtgaa
attactaaaaaataa

DBGET integrated database retrieval system