KEGG   Marinomonas posidonica: Mar181_0514Help
Entry
Mar181_0514       CDS       T01508                                 

Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00860  Porphyrin and chlorophyll metabolism
mpc01100  Metabolic pathways
Module
mpc_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mar181_0514
Enzymes [BR:mpc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Mar181_0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB
Motif
Other DBs
NCBI-ProteinID: AEF53574
UniProt: F6CZR3
Position
complement(559772..561265)
Genome map
AA seq 497 aa AA seqDB search
MPAFSLMVQGTTSDAGKSTLVTALCRLLVKRQLSVVPFKPQNMALNSAVTQDGHEIGRAQ
AVQAQAAHLAPHVDMNPILLKPNTDTGAQVIIQGKAVGNMNAVGYHQYKSIAKQAALDSY
HRLAEQYQAVLIEGAGSPAEINLRARDIANMGFAESIDCPVIIIADIDKGGVFAHLVGTL
DLLSQSEQDRVIGFVINRFRGDISLLQPGLDWLKEHTGKPVLGVLPYLTGFHLESEDAVA
QSPIKDHSTDKLQVVIPVMPRTSNHTDWDALRLHPEVQVTLVGANEPIPPADLVILPGSK
SVQSDLAFLRQQGWENYLQKHLRYGGKVIGICGGFQMLGEHLSDPLGLENQTPGTQTNGF
GFIPMTTVLKEEKQLKQQQGKLIQGQAQITGYEIHSGVSQFTQAHDPLIELDNGEAEGYR
SVDGQIIGTYLHGLFDHTGALNALLEWAGHTQSKAFDYRQHRESEIERLANRVEQHMDID
QLIEQCRRFNIQSACPL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcctttagcttaatggtccaagggacaacctctgatgctggaaaaagcacccta
gtgacagcgctatgccgactcttggtaaaacgccagctctcggttgtgcctttcaaacca
caaaacatggcactcaacagcgcagtcacccaagatggccatgaaatcggccgagctcaa
gccgtacaagctcaggcagctcacttggccccccatgtggacatgaaccccattctgctc
aagcccaacacagacactggcgcccaagtcatcattcaaggcaaagccgtgggcaatatg
aatgcggtcggatatcaccaatacaaaagcatcgccaaacaggccgccttggattcctac
catcgccttgctgaacaatatcaagcggtattaatagaaggggctggcagcccagccgag
atcaacctacgcgctcgtgatattgccaacatgggctttgcggaaagcattgattgcccc
gttatcatcattgccgacatagacaaaggcggtgtctttgcgcatctagtcggcacatta
gacctgcttagccaaagtgagcaagacagggtgattggttttgtgattaaccgttttcgt
ggcgacatcagcctattgcagcctgggctcgactggttaaaagaacatactggcaaacct
gtattaggggtcttaccttatctgacaggctttcatttagagtcggaagacgccgtggct
cagagccccatcaaggaccattcgacagataaactgcaagtggtcattcccgtcatgcct
cgaactagtaatcataccgattgggacgccctgcgcttgcacccagaggtacaagtgaca
ttagtgggtgccaatgagccaatccctcccgctgacctagtgattttacccggcagcaaa
agcgtacaaagtgatctggcctttcttcgtcaacaaggctgggaaaactatttgcagaaa
caccttagatacggcggtaaagtcattggtatctgcggcggcttccaaatgctcggagaa
cacctatcggatccccttgggctagaaaaccaaacaccgggcacacaaaccaatggcttt
ggcttcatccccatgacaaccgtcttaaaagaggaaaaacaacttaagcaacaacaaggc
aagctaatacagggacaagctcagatcacaggctatgaaattcactcaggtgtttctcaa
ttcacccaagctcatgaccccttgatcgaactggataatggcgaagcggaaggttatcga
tctgtcgatgggcaaatcatcggtacttacttacatggtttgtttgatcatactggtgcc
ttaaacgccttgttagaatgggccggacacactcaaagcaaagcatttgattatcgccaa
cacagagagagcgaaattgagcgactggccaaccgcgttgaacaacatatggacatagat
caactcattgagcaatgtcgcaggttcaacattcaatcagcttgcccactctaa

DBGET integrated database retrieval system