KEGG   Marinomonas posidonica: Mar181_0607Help
Entry
Mar181_0607       CDS       T01508                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00260  Glycine, serine and threonine metabolism
mpc00750  Vitamin B6 metabolism
mpc01100  Metabolic pathways
mpc01110  Biosynthesis of secondary metabolites
mpc01120  Microbial metabolism in diverse environments
mpc01230  Biosynthesis of amino acids
Module
mpc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mar181_0607
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mar181_0607
Enzymes [BR:mpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mar181_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEF53664
UniProt: F6D0E2
Position
656548..657933
Genome map
AA seq 461 aa AA seqDB search
MKYISTRGKAPALSFGDVLLAGLANDGGLYVPETLPHYSKDEIASWASLSYQELAFKVMW
PFVEGDIPAEEFKSMIEEAYAGFNHESIAPMVQVGNNEWVLELFRGPTLAFKDFALQLLG
RLMDYVLAKRNEKLVIMGATSGDTGSAAIEGCRHSEHLSIFILHPYQRVSEVQRRQMTTV
IDDNVFNVAVKGNFDDCQGMVKSSFADQSFLKGAKLGAVNSINWARIMAQIVYYFSSALA
VGGPHRNVSFSVPTGNFGDIFAGYLAKKMGLPVDQLVVATNQNDILHRVIAENDMSRQAL
NVTLSPSMDIMVSSNFERLLFDAHGRNGAEIDDLMARFNKGDVSLNDQAWSFVKENFDSY
KVDDKRTCEVITEVHDSAQYLLDPHTAIGLEAARQCWKDKSVPMITLATAHPVKFPEAVE
KAGCDLPNLPEHMKDLFEREESYSVLDNELTQVQSFVAERI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatttcaactcgtggaaaagcaccagccctttcatttggtgatgtgctatta
gctggtctagcaaatgatggcggtttatatgtgccagagactttgcctcattacagtaaa
gatgaaattgcctcttgggctagcctcagctatcaggaattggcttttaaagtaatgtgg
ccttttgttgagggagacattcctgccgaggaatttaagtcgatgattgaagaggcttac
gctggttttaatcatgaatccattgcgcctatggtgcaggtggggaataacgaatgggtg
ttggagctattccgtggtccaaccttagcctttaaagactttgcattacagttgctaggc
cgcttgatggattatgtattggcaaagcgcaacgaaaagctggtcattatgggtgcaacc
tctggtgatacaggttcggcagccattgaaggttgtcgccattcagagcacttaagcatc
tttatcttgcacccatatcagcgagtatcagaagttcagcgtcgtcaaatgacgaccgtg
attgatgacaatgttttcaatgtggcggttaaagggaattttgatgattgtcaggggatg
gtgaaatccagttttgcagatcaatccttcttgaaaggcgctaaactcggtgctgtgaac
tccatcaactgggcgcgtattatggctcagatcgtttactacttctcttctgctttagcg
gttggtgggcctcatcgtaatgtctcgttttcggtcccaacaggtaactttggggacatt
tttgccggttatctggcgaagaaaatgggcctgccagtagatcaactagtggtcgccact
aaccaaaatgatattttgcaccgtgtgattgccgaaaacgacatgagtcgccaagccttg
aatgtaaccttgtcccctagtatggatatcatggtttctagtaatttcgagcgtttgttg
tttgatgctcatggacgtaatggggctgaaattgatgatctaatggcgcgttttaacaaa
ggtgatgtgtcattgaatgatcaagcatggtctttcgtgaaagagaattttgacagttat
aaagtggacgataagcgaacttgtgaggtgattactgaggtgcatgatagtgcgcaatac
ttgcttgatcctcatacagcaatcggacttgaagcggcgcgtcaatgttggaaagacaag
tctgttcctatgatcaccttggcaacagcgcatccggtgaaattcccagaagccgtggaa
aaagcaggttgtgacctaccaaacttgcctgagcacatgaaagatttgtttgaacgtgaa
gagtcttattcggtgttagacaatgaactgacacaagtgcagtcttttgttgctgagcgt
atttaa

DBGET integrated database retrieval system