KEGG   Marinomonas posidonica: Mar181_0649Help
Entry
Mar181_0649       CDS       T01508                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
mpc  Marinomonas posidonica
Pathway
mpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Mar181_0649
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mpc02044]
    Mar181_0649
Secretion system [BR:mpc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mar181_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345 Phage_base_V
Motif
Other DBs
NCBI-ProteinID: AEF53705
UniProt: F6D0Y2
Position
708321..710384
Genome map
AA seq 687 aa AA seqDB search
MSQLADPEYSNLVVIDSDGDEYVCTSLSVRESVNGISDIKALVQVSSGTPNSWVGTAVEC
AVYLELGSGRSANRQYKGYVVSAKSQSQVADSSYFTMELHIQPWLGLLAYGKSCRVFQEQ
TVQAIVTSIFDEIGFSGDYSVNSMPSSIREYCIQFNESDLDFVLRLLAEEGVHFYYDKND
GSSTLKLQDASKPFSSDEVISLDHVSSPGGDNEVVKEWAYQNQFHSASLEIANFDYTQSK
LVTSGVKSSQYSISGNTKLTNYRYPVAAATGDYSDLSGTQITIQRAQLDSGYSRVYGETE
SMDLAVGFYLEMASHPDSAQEGKLLVIEAEHDFQSAPGSTFTHNTRFVGMPEDALFYPSH
RPKPVVHGLQSALVSGQTTGEPSCDESGRLRIKFHWDEETGDETSCYVRVAQPMAGSGYG
FQFLPRAGHEVLVSFINGDPDQPVIVSSVYNSTYKPPYATASTTQSGIKTKLAGEANELR
FDDKKDNESFYMHAAKDFLHEVVNDHTETIAGEKKTTVTKSITEAVTEKYTLSSKDNMAL
STDKAYTLSATDSISEDSEKITLTATDTLKLVVGDSSITIKSDSIDISSSSITLNGDSDI
TLNGGDISQSGGSFSVDSDGSASISSGSSMSLSAGSSLTAEASSSTSISGLNVTISADVS
ATVSGSASAEISSDGSTTVSGSIVMVN
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcttgcagatccagagtacagcaacctagttgtgatcgatagtgatggcgat
gaatacgtatgtacttcattgtcagtgcgtgaatcggttaatggtatcagcgacataaaa
gcacttgttcaagtctcttcaggaacgcctaatagctgggtgggtacggcagtcgaatgc
gctgtgtatttagagctaggatcaggtcgttcagcaaatagacaatataaaggctatgtt
gtttctgcaaaaagccaatctcaggtggctgattctagctatttcactatggagttgcac
attcagccttggttgggattgcttgcctacgggaaaagttgtcgcgtatttcaggagcaa
actgtacaagctatagtgacatctatcttcgatgaaataggttttagtggtgattacagc
gttaacagtatgccttcttcgattcgggaatattgcattcagtttaacgagtctgatttg
gattttgtgttgcgactgcttgctgaggaaggcgttcatttttattacgataaaaatgat
ggttcttcgacgttgaagctacaggatgcttctaagccatttagcagtgatgaagtcatt
tctttggatcatgtatcatcaccgggtggtgataatgaagtggtgaaagagtgggcttat
cagaatcaatttcatagcgcttctttggaaatcgcaaattttgattacactcagtcaaaa
ttagtgaccagtggggttaaaagttctcaatattctatttcaggaaacaccaagttaacc
aattaccggtatcctgtggctgcagcaacaggtgattactccgatctctctgggacacaa
ataacgatccaaagagcccaactagattcaggctacagtcgtgtttacggtgaaactgag
tctatggatttggctgtaggcttctatttagagatggcatctcatcctgatagtgctcag
gaaggaaagctccttgttattgaagcggagcatgattttcagtctgcgccaggctctacc
tttacccataatactcgctttgttggcatgccagaagatgctctattttacccaagtcac
cgccctaaacctgtcgtacatgggttgcaatctgcgctagtgtctggtcaaaccactggt
gagccatcttgcgatgagtcaggtcgactcagaattaaattccattgggacgaagaaacg
ggtgatgaaacaagctgttatgtgcgagtagcgcaacctatggcgggcagtggttatggc
tttcaatttttgcctcgtgccgggcatgaagtgttagtgagctttattaatggtgacccg
gatcagcctgtgattgtctcaagtgtttataacagcacttataaaccaccttacgccacg
gccagtactacgcaaagtggcattaaaacgaagttggccggtgaagctaatgagttaagg
tttgatgacaaaaaggacaatgagtctttttacatgcatgccgcgaaagattttctgcat
gaggtggtaaatgatcatactgagaccattgctggtgagaaaaagaccactgtaactaag
agtattaccgaagcggtaactgagaagtatacgctgtcttccaaggataatatggccttg
tctacggacaaggcttataccttaagcgccacggactctatatcagaggacagtgaaaag
attaccttaaccgctacagacacattgaaattggtcgtgggcgatagctctataacgatt
aaaagtgactctatcgatattagcagtagctctatcactttaaatggagattcggatatt
accttaaacggaggagatatcagccagtctggaggttcatttagtgtggattcagatggt
tctgccagtataagttcagggagttcaatgagcctaagtgcaggaagttctttaaccgca
gaggcatccagcagtacatcaatatcaggattgaatgtaactatttcagcggatgttagt
gcgacggtatcaggtagtgcttcggcagagatatcttcagatgggtcgacgactgttagt
ggcagcattgtgatggtgaactag

DBGET integrated database retrieval system