KEGG   Marinomonas posidonica: Mar181_0658
Entry
Mar181_0658       CDS       T01508                                 

Definition
(GenBank) GPW/gp25 family protein
Organism
mpc  Marinomonas posidonica
SSDB
Motif
Pfam: GPW_gp25 MucB_RseB_C DUF1921
Other DBs
NCBI-ProteinID: AEF53714
UniProt: F6D0Z1
Position
717791..718213
AA seq 140 aa
MIFWNTFLKDEGSVGDEMLEAIRYQLTALLNSEAPMMNLPKGFKEIEASNMRFGLDSVYS
ISSQVDKDQFARSVEHWVRAFEPRLAEVSVFIEESDPQKNMICFSLMAKIKTPNGNHVFL
FDSNISLSNQVAKLEGQEVV
NT seq 423 nt   +upstreamnt  +downstreamnt
atgatattttggaatacatttctaaaagacgagggctcagttggcgatgagatgttggaa
gctatacgttatcaactgacggctttacttaattctgaagcaccaatgatgaatttgcca
aaaggctttaaggagattgaagcgtctaatatgcgttttggtcttgatagtgtttacagt
attagtagtcaggtggataaagatcaatttgctcgctctgttgagcattgggtgcgcgct
tttgaaccacgtttggctgaagtgagcgtctttattgaagaaagtgacccacaaaagaat
atgatttgtttctcgttgatggcgaaaataaaaacaccaaatggtaatcatgtttttttg
tttgattcgaatattagtttatcgaatcaggtggctaaattagagggtcaagaagttgtc
tga

DBGET integrated database retrieval system