KEGG   Marinomonas posidonica: Mar181_0663Help
Entry
Mar181_0663       CDS       T01508                                 

Definition
(GenBank) FHA domain containing protein
  KO
K11894  type VI secretion system protein ImpI
Organism
mpc  Marinomonas posidonica
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mpc02044]
    Mar181_0663
Secretion system [BR:mpc02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Mar181_0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA Yop-YscD_cpl Ku_PK_bind
Motif
Other DBs
NCBI-ProteinID: AEF53719
UniProt: F6D0Z6
Position
724300..725283
Genome map
AA seq 327 aa AA seqDB search
MSISLQLVELPENEQVTSRQISLPDSGGTIGRSFDCTIQLPDFNRSLSRVHAEIVLSQKG
RYQLIDRSTNGVYVNGRLIGKGAKHTLADGDNIKMGAYTLLVSDMESLFVQEDIPVLDES
LDDPNSAVFDVKNLEMDSPIKANNPIDQKSYNSLFNEEEADVPSFSKKNVMEEDSFGYDP
FESMQEDLQMRDPNEVTEVDEDAEVIQFNANDLAVSTYNEARDEEKRALHNSVMQLNKII
EQQQNTLSGSIAHERLMSCLEATFEKFIAELSPVNLEDEFNSYLSGWGAKDKKYWSLYKK
QFIRKQERGEYYRQFYALLFEELREKR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcagcttacagctcgtcgagttgcctgaaaatgagcaagttacaagtagacag
atttctctacctgattctggtggaacaattggacgttcgtttgactgtactattcagcta
ccagattttaaccgttctttgtctagggttcatgccgaaatcgttttatctcagaaaggc
cgttatcagctgattgacagaagtacgaatggagtctacgtcaatggccgcttaattggt
aaaggcgctaagcacactcttgctgatggcgataatattaagatgggggcttacactctt
ttggtgagcgatatggaatcgctatttgtacaagaggatattcctgttttagatgagagt
ctggatgatcctaactctgctgtatttgacgtgaaaaatttagaaatggattctcctatt
aaagccaataatcctatagatcaaaagagctacaactcactttttaatgaagaggaagct
gatgtaccctctttttcaaaaaaaaatgtgatggaggaagattcctttggttatgatcca
tttgaatcgatgcaagaagatctacagatgcgggatcctaatgaggtcacggaagtagat
gaagatgccgaggtgatacaatttaatgcgaacgacttggcggtcagtacatacaatgaa
gcaagggacgaagagaaaagagcattgcacaatagtgtcatgcagttgaacaaaattatt
gaacaacagcaaaatacgctctcgggttcaattgcccatgaacggttaatgtcctgcttg
gaagctacttttgagaagttcattgcagaattaagccctgttaatcttgaggacgagttt
aatagttacctttctggttggggggctaaggataaaaaatattggtctttatataaaaag
cagtttattcgtaagcaagaacgtggcgagtattaccgtcagttttatgccttgcttttt
gaagaacttagagagaaacgatga

DBGET integrated database retrieval system