KEGG   Marinomonas posidonica: Mar181_0680Help
Entry
Mar181_0680       CDS       T01508                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00620  Pyruvate metabolism
mpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mar181_0680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mpc02000]
    Mar181_0680
Enzymes [BR:mpc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Mar181_0680
Transporters [BR:mpc02000]
 Other transporters
  Primary active transporters [TC:3]
   Mar181_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 PTS_EIIA_1 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEF53736
UniProt: F6D113
Position
745995..747779
Genome map
AA seq 594 aa AA seqDB search
MKTIKQPLGITDVVLRDAHQSLFATRLRIDDMLPIAEKLDNVGFWSLESWGGATFDSCIR
FIGEDPWDRIRELKKAMPKTPQQMLLRGQNLLGYRHYADDVVAKFVERAAANGVDVFRIF
DAMNDPRNLEQAIKSVKEVGKHAQGTISYTKSPVHTTKNWVDYAKTLEDMGADSIAIKDM
SGILTPYDAYDLVSLLKEQTDLEVQLHAHATSGLSDMTILKSIEAGIDRVDTAISSMSMT
YGHSSTESVVAALQGTDRDTELDLEALEDIAAYFREVRKKYAKFEGSLRGTDSRILIAQV
PGGMLTNMESQLKEQGAADKFDDVLKEIPKVREDLGLIPLVTPTSQIVGTQAVLNVLTGE
RYKSISKETAGILKGEYGAAPAEFNKELQQRVLDGAEPITCRPADLLEPEVEKLTQELQG
LAKEKQINLSDELIDDVLTYALFPQIGLKFLENRDNPDAFEPVPTGQELVDAAKQETGPA
VYTVSVSGQSYVVEVAEGGDISQIQPVASSVSAPTAVVQTAPAAGGEDVPAPLAGNIFKV
LVKPGQQVQEGETIMILEAMKMETEISAPKAGVVGSIHVKEGDAVQVGQALLSL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattaaacaacctcttggtattacggacgtcgtgttgcgtgatgcccatcaa
tcattatttgcaactcgtctccgaattgatgacatgttgcccattgctgaaaagctcgac
aatgtcggtttttggtcgttggaatcttggggtggtgccacctttgattcttgtattcgt
tttatcggtgaagacccttgggatcgaattcgcgaattgaaaaaagccatgcctaaaaca
cctcaacaaatgcttttacgtgggcaaaatctactagggtatcgccattatgcagacgat
gttgttgctaagtttgtggagcgagctgcagctaatggtgtagatgtgttccgtattttt
gatgcgatgaacgatcctcgaaaccttgagcaagccattaaatcggttaaagaagtgggt
aagcatgcgcaaggtactatttcctatactaaaagccccgttcacacgaccaagaattgg
gtggattatgcgaaaacccttgaagatatgggagcagattcaatcgccattaaagacatg
tctggtattttgacgccttacgacgcttatgatctagtgtctttgttaaaggagcagaca
gatcttgaggtgcaattgcatgcccatgcgacttcaggtttgtctgacatgaccattttg
aagtcaattgaagctggaatcgatcgagtggatacggccatttcatctatgtctatgact
tacgggcattcttcaactgagtcggtagtggcagcattgcaaggaaccgatagagatacg
gagctggatttggaggcgctagaagacattgcggcgtacttccgagaagttcgtaagaag
tatgcgaaatttgaaggctcgctgcgtggtaccgactctcggatcctgattgctcaagtg
ccaggcggtatgttgacaaacatggaaagtcaactgaaagagcaaggcgctgcggataag
tttgatgatgtattaaaagaaattcccaaagtacgtgaagatcttggtttgattcctttg
gtaacgccgacatctcagattgtaggtacacaagctgtattgaatgtgttgactggtgag
cgttataaatccatttcaaaagaaacagcaggtatcttgaaaggtgagtatggtgctgcg
ccagcagaatttaataaggaattgcagcaaagggtgttggatggtgctgagccgattact
tgtcgtcctgcggacttacttgagcctgaggtcgaaaagttgacccaagagttgcagggg
ttggctaaagaaaagcaaattaatttatctgatgaattaattgatgatgttttgacgtat
gccctgttcccacagatcggtttgaagtttcttgagaatcgcgacaatcctgatgcattc
gagccggttccgactggacaggagttggttgacgctgctaaacaagaaaccggcccggcg
gtctacactgtcagtgtgtcagggcagagttatgttgttgaagtggcggaaggtggtgac
attagccaaattcagcctgttgcttcatctgtttctgcaccaactgccgttgttcaaact
gcccctgctgctggcggcgaagatgtaccggcaccgttagctggaaacattttcaaagtg
cttgtgaagccagggcaacaggttcaagaaggtgaaaccattatgattctagaggcgatg
aaaatggaaaccgaaatttctgctcctaaagcaggtgtggttggttctattcatgttaag
gaaggtgatgctgtacaagtaggtcaagcattgctgtcactttaa

DBGET integrated database retrieval system