KEGG   Marinomonas posidonica: Mar181_0737Help
Entry
Mar181_0737       CDS       T01508                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00040  Pentose and glucuronate interconversions
mpc00052  Galactose metabolism
mpc00500  Starch and sucrose metabolism
mpc00520  Amino sugar and nucleotide sugar metabolism
mpc01100  Metabolic pathways
mpc01130  Biosynthesis of antibiotics
Module
mpc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mar181_0737
   00052 Galactose metabolism
    Mar181_0737
   00500 Starch and sucrose metabolism
    Mar181_0737
   00520 Amino sugar and nucleotide sugar metabolism
    Mar181_0737
Enzymes [BR:mpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mar181_0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEF53793
UniProt: F6CRN0
Position
complement(819635..820471)
Genome map
AA seq 278 aa AA seqDB search
MIRKCLFPVAGYGTRFLPATKSMPKEMLPIVNKPLVQYGVEEATAAGLNNVTFVTGRGKR
AIADHFDISYELEHQISGSSKEKYLEGIRHLIDHVNFSFTRQNNMLGLGHAILTGEPLIG
DEAFGVVLADDLCFGEDDGVMAQMVKLYNQFRCTIVAIEEVPEDEVHKYGVIKGESMMEG
LFRVTDMVEKPSKEDAPSNLAIIGRYILTPDIFDKIRNTPPGRNGEVQITDAIMQQAKEG
CVLAYKFKGKRFDCGSVDGFVDATNFCYKNIYKDPTES
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcaaatgtctattccctgttgcaggctacggcacccgttttttgccagccact
aagtccatgcccaaagaaatgcttccaatcgttaacaaaccacttgtgcaatatggtgtc
gaagaggcaacagccgcaggtcttaacaatgttacttttgtaacaggacgaggcaaacga
gccattgcagatcactttgatattagctacgaactggaacaccagatctcaggctccagt
aaagaaaaatatcttgaaggcattcgtcaccttatcgaccatgtaaacttttcttttact
cgtcaaaacaacatgttaggtctaggtcatgccattttgaccggcgaacctttaatcggt
gacgaagcctttggcgtcgtcttagcggacgacctttgtttcggtgaagacgacggtgtc
atggcgcaaatggtaaaactctacaaccaatttcgttgtactattgtggccattgaagaa
gtacctgaagacgaagtacataagtatggcgtgattaaaggtgaatccatgatggaagga
cttttccgagtgactgacatggttgagaaaccatccaaagaagacgcgccatccaacctt
gctattattggtcgctatattcttacgccagatatctttgacaaaattcgcaatacaccg
cctggtcgaaatggtgaagtacaaattacagatgccatcatgcagcaagcaaaagaaggg
tgtgttttggcttataaattcaaaggtaagcgctttgattgtggtagtgtcgatggtttt
gttgacgcgacgaatttctgctacaaaaacatctataaagatccaactgaatcttaa

DBGET integrated database retrieval system