KEGG   Marinomonas posidonica: Mar181_0889Help
Entry
Mar181_0889       CDS       T01508                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00360  Phenylalanine metabolism
mpc00362  Benzoate degradation
mpc00620  Pyruvate metabolism
mpc00621  Dioxin degradation
mpc00622  Xylene degradation
mpc00650  Butanoate metabolism
mpc01100  Metabolic pathways
mpc01120  Microbial metabolism in diverse environments
mpc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mar181_0889
   00650 Butanoate metabolism
    Mar181_0889
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Mar181_0889
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mar181_0889
   00622 Xylene degradation
    Mar181_0889
   00621 Dioxin degradation
    Mar181_0889
Enzymes [BR:mpc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mar181_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh Shikimate_DH DapB_N Glu_dehyd_C F420_oxidored NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AEF53941
UniProt: F6CSV1
Position
971987..972889
Genome map
AA seq 300 aa AA seqDB search
MSNRVAIIGTGSIGIDLMYKVLKSKQLDLRYVVGRRNESPGMREAMKQNITVSSNGIDFL
EENIDGFDIVFDATSANSHISNDKIFARNNKFAIDLTPAKIGDLCVPVINMETLVNNRNI
NLITCGGQACLPLAYAIKRSCEEVEYIEVISSISSDSAGLATRENLDEYVTTTEFALKEF
TNAKLSKAILNINPATPQVCMQTTLYAKCSGIKKEALKLEIHDVVKRVRNYVPGYNLILE
PIIDENQITLAVQVFGAGDYLPAYAGNLDIINSAAISIAEFRSQIPSELKAKSFMEEELA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatagagtagcaataattggaaccggtagtattggtattgatttaatgtacaaa
gtactcaaatcgaaacaactggatttacgttatgtagttggtagaaggaacgagagtcct
ggcatgcgtgaagcaatgaaacaaaacataactgtgtcgagcaatggtattgatttcttg
gaagagaatattgatggatttgatattgtttttgatgcaacgtcagcaaactcccatatt
agtaatgataaaatattcgctcgtaataacaaatttgcgattgatctcacccctgcaaaa
attggagacctttgtgttccagtaattaatatggagactttggtaaataatagaaacatc
aacttaattacatgcggtggtcaagcatgcctcccattggcttatgcgatcaaaaggtca
tgtgaagaagttgaatacattgaagtaatttcaagcatttcatcagatagtgcggggcta
gcaaccagagaaaatcttgatgaatatgtaacaacaactgaatttgccttaaaagagttt
acaaatgccaaactttctaaagcaattcttaatatcaatccagcaacaccacaagtgtgt
atgcaaacaaccttgtatgcaaaatgttctggaattaaaaaagaagctcttaaattagaa
atacatgatgtggtcaaaagagtaagaaattatgttccaggatataatttgatcttagaa
ccgattattgatgaaaatcaaatcacgttagcagttcaagtctttggtgctggtgattat
ctacctgcatatgcgggaaatctcgatattataaactctgcagccatatccattgctgaa
ttccgatctcaaattccctcagaattaaaagcaaaatcctttatggaggaagaactagca
tga

DBGET integrated database retrieval system