KEGG   Marinomonas posidonica: Mar181_1011Help
Entry
Mar181_1011       CDS       T01508                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00071  Fatty acid degradation
mpc00072  Synthesis and degradation of ketone bodies
mpc00280  Valine, leucine and isoleucine degradation
mpc00310  Lysine degradation
mpc00362  Benzoate degradation
mpc00380  Tryptophan metabolism
mpc00620  Pyruvate metabolism
mpc00630  Glyoxylate and dicarboxylate metabolism
mpc00640  Propanoate metabolism
mpc00650  Butanoate metabolism
mpc00900  Terpenoid backbone biosynthesis
mpc01100  Metabolic pathways
mpc01110  Biosynthesis of secondary metabolites
mpc01120  Microbial metabolism in diverse environments
mpc01130  Biosynthesis of antibiotics
mpc01200  Carbon metabolism
mpc01212  Fatty acid metabolism
mpc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mar181_1011
   00630 Glyoxylate and dicarboxylate metabolism
    Mar181_1011
   00640 Propanoate metabolism
    Mar181_1011
   00650 Butanoate metabolism
    Mar181_1011
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mar181_1011
   00072 Synthesis and degradation of ketone bodies
    Mar181_1011
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mar181_1011
   00310 Lysine degradation
    Mar181_1011
   00380 Tryptophan metabolism
    Mar181_1011
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mar181_1011
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mar181_1011
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mar181_1011
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpc04147]
    Mar181_1011
Enzymes [BR:mpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mar181_1011
Exosome [BR:mpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mar181_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEF54060
UniProt: F6CU08
Position
1099317..1100492
Genome map
AA seq 391 aa AA seqDB search
MKAVIVAAARTPIGAFNGALSSLSAVQLGTQLLSGMLAKQPVLKDHIEEVILGQVLAAGC
GQNPARQTALQAGLPKHVGAMTINKVCGSGLKAVQLAAQSVLSGDSAMVVAGGQESMSQA
AHVLPNSRNGKKMGSWELLDTMVIDGLWDAFNDYHMGQTAENIADRWHINRDEQDAFAVH
SQQKAAQAQTSGRFAEEILPISIPQRKGEPVIVEADEQIRSDTSLDSLAKLRPAFLKEGT
VTAGNASTLNDGAAMVVVTSDEEAKRLGLPILAVIEAASAAGVEPEIMGTGPIVATQKTL
EKVHWQISDLDLIEANEAFAVQALCVNKELGLDPEKVNVNGGAIALGHPIGASGCRILVS
LVHEMPRRDAHKGLATLCIGGGMGVAMLVSR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttatcgttgctgcggcaagaaccccaattggtgcgtttaatggggcttta
tcttctttgagtgcggtgcaattaggcactcagttattgtctggcatgttagccaagcag
cctgttttaaaagatcacattgaagaggtcattttgggccaagttttggcggcgggttgt
ggtcagaatccagcacgacaaacagcattgcaagccggtttgcctaagcatgttggtgcg
atgaccattaataaggtttgtggttccggtttgaaagcggtgcagctagcagcgcaatct
gtattgagtggtgattctgccatggtggtcgctggtggccaagaaagtatgagtcaagcg
gctcatgttttgccaaatagccgcaatggtaaaaaaatgggctcatgggaattactggat
accatggtgattgatggactttgggatgctttcaacgattatcacatgggacaaaccgct
gaaaacattgccgatcgttggcatattaatcgtgacgaacaggacgcgtttgctgtgcat
tctcaacaaaaagccgctcaagctcaaacgtcagggcgttttgccgaagaaatccttcct
atttccattcctcagcgtaagggcgagcctgtcattgtcgaagcggatgaacaaatccgt
tctgatactagcctagattcactggcgaaacttcgcccagcctttctgaaagaaggcacg
gtaaccgctggtaatgcatcgactttaaatgatggtgccgctatggtcgttgtgacgtct
gatgaagaagcaaaacgtctaggtctgcctattttagcagtaattgaagcggctagtgcg
gcaggcgtggagcctgagatcatgggaaccggtccaattgtcgcgactcaaaagaccctt
gaaaaagtacattggcagatatctgatctggatttaattgaagccaatgaagcgtttgcc
gtgcaagccctatgcgtcaataaagaattgggtttagacccagaaaaagtcaatgttaat
ggtggcgctattgcacttggccaccctatcggtgcttcgggctgccgaatattggtcagt
ttggttcatgaaatgcctcgtcgagatgctcataaagggctggcgaccttgtgtatcggc
ggaggtatgggcgtcgctatgctggtctctcgataa

DBGET integrated database retrieval system