KEGG   Marinomonas posidonica: Mar181_1053Help
Entry
Mar181_1053       CDS       T01508                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 3
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00010  Glycolysis / Gluconeogenesis
mpc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mar181_1053
Enzymes [BR:mpc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     Mar181_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Acid_PPase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AEF54102
UniProt: F6CU50
Position
1150486..1151106
Genome map
AA seq 206 aa AA seqDB search
MKQDHNIRVVMFDLGNVLVDLGDVGEMHAMLNTQGEESEVWRQWLASPAVAAFDAGRISF
DAFAEALLKEVASETDKHTFMQAFEAWPRGLYAGALALVDEVKPEYHRAILSNTNAAHWP
RLMDEMGLAGHFHHYFASHQLGLVKPDRAVYEEVLKRLDVAPQEILFIDDNQINIDTATT
LGIHAHRVKGIAEARQVLSQYQVLEP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagaccataatattcgtgttgtaatgtttgacttgggaaatgttctagtggat
ttgggagacgttggggaaatgcatgctatgttgaatactcaaggcgaagagtctgaggta
tggcgacagtggttagcatctcctgctgtcgcggcatttgatgcgggccgaatttccttt
gatgcctttgctgaagctttactgaaagaagtggcaagtgaaaccgacaaacacactttt
atgcaagcttttgaagcttggccaagaggtttgtacgctggtgccttagccttggtggat
gaggttaaacctgaatatcatcgtgctattttgtcgaacacgaatgccgctcattggcca
agactgatggatgaaatggggttagctgggcattttcatcattattttgcttctcatcaa
ctaggcttggtaaagccggaccgtgcggtttatgaggaagtgctgaagcgcttagacgta
gcgccacaagagatcttgtttattgatgataaccaaataaacatcgataccgcgacaaca
ttggggattcatgcccatagagtgaaaggaattgcagaggctcgacaggttttaagccaa
tatcaggtattagagccataa

DBGET integrated database retrieval system