KEGG   Marinomonas posidonica: Mar181_1605Help
Entry
Mar181_1605       CDS       T01508                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00260  Glycine, serine and threonine metabolism
mpc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mpc01100  Metabolic pathways
mpc01110  Biosynthesis of secondary metabolites
mpc01130  Biosynthesis of antibiotics
mpc01230  Biosynthesis of amino acids
Module
mpc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mar181_1605
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mar181_1605
Enzymes [BR:mpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mar181_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth B12-binding BtpA PI-PLC-X
Motif
Other DBs
NCBI-ProteinID: AEF54644
UniProt: F6CZA7
Position
1726726..1727532
Genome map
AA seq 268 aa AA seqDB search
MSRIKQCFENLEKSGKKALIPYITAGDPSPKHTVTMMNALVDAGADVIEIGMPFSDPMAD
GPVIQLACERSLAAGTSVRKVLEIIAEFRQGNSTTPVVLMGYLNPIEFFGYQEFADAAKE
AGVDGVLLVDLTPEEATDVVECFRQNEIDLIYLLSPTTTLERAKKICALASGYVYYVSVK
GVTGSSELDVDSVKQHVETLRSVTSLPIGVGFGIRDAKTAAAVSRCSDGVIVGSVLVNCI
AENKDQQKEYIADALGAILTPMRSEMDA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcataaagcaatgttttgaaaatttagaaaaatctggtaaaaaggcgctcatt
ccatatatcacggcaggtgacccttctccaaagcacacagtgaccatgatgaatgcgcta
gtggatgcgggtgccgatgtaattgagatcggtatgccgttctctgatccaatggcggat
ggtccggttattcagcttgcctgtgaacgcagtttggccgctggcaccagtgtccgaaaa
gtattggaaatcattgctgagtttaggcaaggcaatagcactaccccagtggttttgatg
ggctatttaaacccaattgagttctttggttatcaagaatttgctgatgcagcaaaagaa
gctggggtagatggcgttttattagtagatctgactccagaagaggcgacagatgtagta
gaatgcttccgacaaaatgagattgatctgatttacttgctgtctccgactaccacgctt
gagcgagcaaagaaaatttgtgccctagcgtctggttatgtgtattacgtttcagtaaaa
ggcgtaacaggttcaagtgaattggacgtggacagtgttaagcagcatgtagagacttta
cgcagtgtaacgtcattaccgattggggtaggttttggcatccgtgatgcaaaaacggcc
gccgcggtgagtcgttgctctgatggtgtgattgtcggtagcgtattagtgaattgcatt
gctgaaaataaagatcaacaaaaagaatatatagctgacgctctaggggcaattttgact
ccgatgcgtagtgaaatggacgcctga

DBGET integrated database retrieval system