KEGG   Marinomonas posidonica: Mar181_1876Help
Entry
Mar181_1876       CDS       T01508                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mar181_1876
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mpc01007]
    Mar181_1876
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mpc03016]
    Mar181_1876
Enzymes [BR:mpc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     Mar181_1876
Amino acid related enzymes [BR:mpc01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Mar181_1876
Transfer RNA biogenesis [BR:mpc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Mar181_1876
 Prokaryotic type
    Mar181_1876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 Tex_N
Motif
Other DBs
NCBI-ProteinID: AEF54914
UniProt: F6D1A7
Position
complement(2040595..2041977)
Genome map
AA seq 460 aa AA seqDB search
MLKIYNTLSGKKEIFKPIEEGKVGMYVCGNTVYDFCHIGHARAMISFDVISRFIRHLGYE
LNYVRNITDVDDKIIKRAEENNETTQALTERMIAAQREDELRLGNKMPDREPKATEFMQQ
IIDMVQVLIDKGFAYQGTSGDVYYRATAFKEYGKLNNRKLEDMLAGARIDVETAKEHPAD
FVLWKQAKVGEVAWESPWGLGRPGWHIECSAMSTNCLGSHFDIHGGGPDLKFPHHENEIA
QSEAATGKDYVNYWMHCGAVRVNNEKMSKSLGNFFTVRDVLEKYNPEVVRYLMVSSQYRS
PIDYSDQSLNEAKVALERLYTALRQQSVAEEWVASEYTARFEEAMQDDFNTPVAVSVLFE
LVRELNKAKAEESDKAANLAAELKSLASLLGLLDQVPEYFLQNSTITAGLDESAIQALID
ERTQARKDKNFARSDEIRDQLADQGIELLDSREGTTWTRS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagatttacaacaccctcagtgggaagaaagaaattttcaaaccaattgaagaa
ggtaaggttggtatgtacgtgtgtggcaacacggtatacgatttttgccatattggtcat
gctcgcgccatgatttcttttgacgtgatttcacgctttattcgtcatttgggctacgaa
ctgaattatgtccgaaatatcacggatgtggatgacaagatcattaagcgtgcggaagaa
aataatgaaaccacgcaagctttaactgagcgtatgattgcagcgcagcgtgaagatgaa
ttacgtttaggtaataaaatgcctgatcgtgagccgaaagccactgaattcatgcaacaa
atcatagatatggttcaagtcttgatcgacaaaggttttgcgtatcagggtacgtctggt
gacgtctattatcgagctactgcgtttaaagaatatggcaagcttaataatcgcaaactg
gaagacatgctggcgggtgcacgtattgatgtagaaacagcaaaagagcatcctgctgac
tttgttttgtggaagcaagcaaaagtcggagaagtggcttgggagtcaccttgggggctg
ggtcgtccaggttggcacattgagtgttcagcgatgtcaactaattgcctaggcagtcat
ttcgatattcatggtggtggtcctgatcttaagttcccgcaccatgaaaacgagatcgcg
caatcggaagcggcgacgggcaaggattatgtgaactattggatgcattgtggtgcggtt
cgcgttaacaacgaaaagatgtccaaatcattggggaattttttcacggtgcgtgatgta
ttggaaaaatacaaccctgaagtggttcgttatttgatggtgtctagccaatatcgtagt
ccgattgattattctgatcaaagccttaacgaagctaaagtggcgctggagcgcttgtat
acggcgttgcgccagcagagtgttgctgaagaatgggttgcctcagaatatacggctcgt
tttgaagaggcgatgcaggacgatttcaacacgcctgtcgctgtttctgtgttgtttgaa
ttggtcagagagttgaataaagcgaaagcggaagagagtgataaagcggccaacttggcg
gcggagttgaaatctttagcaagcttattaggtcttttggatcaagtgcctgaatatttc
ttacaaaatagcaccattacggcagggttagatgagagcgcgattcaagccttgattgat
gagcgtactcaggctcgcaaagacaaaaactttgcacgcagtgatgaaattcgagaccag
ctagcggatcaagggattgagcttttggacagtcgcgaaggcacgacttggacaagaagc
tag

DBGET integrated database retrieval system