KEGG   Marinomonas posidonica: Mar181_2232Help
Entry
Mar181_2232       CDS       T01508                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00450  Selenocompound metabolism
mpc00970  Aminoacyl-tRNA biosynthesis
mpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Mar181_2232
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mar181_2232
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mpc01007]
    Mar181_2232
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mpc03016]
    Mar181_2232
Enzymes [BR:mpc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Mar181_2232
Amino acid related enzymes [BR:mpc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Mar181_2232
Transfer RNA biogenesis [BR:mpc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Mar181_2232
 Prokaryotic type
   Other AARSs
    Mar181_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AEF55268
UniProt: F6CUU2
Position
2455208..2457259
Genome map
AA seq 683 aa AA seqDB search
MAQTQRKILVTSALPYANGPIHLGHMLEHIQTDIWVRFQKMRGHLCTAVCADDAHGTAIM
IKAEQQGITSEELIDGVRKEHMADFNDFLIGYDNYYSTHSDENREISTSIYKALRDNGKI
SVRSIVQAYDPEKEMFLADRFIKGTCPKCKAEDQYGDNCEVCSATYTPMEMINPRSVYSG
ATPIEKDSEHYFFKLPDFQDFLAEWTRSGTLQDQVANKLSEWLDSGLKEWDISRDAPYFG
FEIPDAPGKYFYVWLDAPIGYMASFKNLCDRTEGLEFDDYWAKDSDAELYHFIGKDIINF
HALFWPAMLDCAGYRTPTGVNAHGYVTVDGEKMSKSRGTFIKARTYLKHLDPQYLRYYYA
AKLNSRVDDIDLNLGDFLQRVNSDVVGKVVNIASRTASFINKKFDGQLATDVSEADMIQS
FIDAGEVIAEHFESREYGKAIREIMRLADVANEYIAVQAPWVLAKDEATLPKVQDVCTVA
LNLFSILATYLKPVMPNLVTDAEAFLGKELTWDNRSELLFGNTVNKFKPLMGRIEQKQID
DMIEEGKAEAAVEAAAKEATQPAQAVTELSKEPIEAEINFDDFAKVDLRIALIVKAEHVE
KANKLLKLTLDIGGETRTVFSGIKSAYKPEDLEGKYTVMVANLAPRKMKFGLSEGMVLAA
GPGGEEIYLLEPHAGAKPGQRVM
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaacgcaacgtaaaatactcgtcaccagcgccctaccttatgctaatggtcca
atccatttgggtcatatgctggaacacatccaaactgacatctgggtgcgttttcagaaa
atgcgcggtcacttgtgtacagcggtttgtgcggacgatgctcatggcaccgccatcatg
atcaaggccgaacaacaaggcatcacttcagaagagttgattgacggtgtgcgcaaagag
cacatggcggactttaatgacttcttgattggttacgataactattactcaactcactca
gacgaaaaccgcgagatctccaccagtatttataaagcgttgcgtgataacggcaaaatt
tcagtgcgttccatcgtgcaagcctatgatccagaaaaagaaatgtttcttgcagatcgt
ttcatcaagggcacctgccctaagtgtaaagcagaagatcaatacggcgacaactgtgag
gtctgttctgcgacttacacgccaatggaaatgatcaaccctcgctctgtttattctggt
gcgacgccgattgaaaaagactctgagcattatttcttcaaattgccagatttccaagat
ttcctagcagaatggacgcgcagcggcaccttgcaagaccaagtcgcgaacaagctatct
gaatggttagattctggattaaaagaatgggacatcagtcgtgatgcgccttacttcggc
tttgaaatcccagacgccccgggcaagtacttctacgtttggctagacgcgccaattggt
tacatggcgagctttaaaaacttatgtgatcgcactgaaggtttagaatttgatgattac
tgggcaaaagactcagacgctgagctatatcacttcatcggtaaagacatcattaacttc
cacgccttgttctggccagctatgttggattgcgctggctatcgtacgccaacaggcgtt
aatgcacacggttacgtaaccgtagacggcgaaaaaatgtctaaatcgcgcggtactttt
attaaagctcgtacttacttgaagcatttagacccacaatacttacgttactactatgcc
gctaaactaaactctcgtgttgatgatatcgaccttaacctaggcgatttcttgcaacgt
gtaaactcagacgtggttggcaaggtggttaacattgccagccgtaccgccagcttcatt
aacaaaaagttcgatggtcaattagcgactgacgttagcgaagcggacatgattcaatcc
ttcatcgacgctggcgaggtgattgctgagcatttcgagagccgcgaatacggtaaagcc
attcgtgaaatcatgcgccttgctgacgtagcaaacgaatacattgcagttcaagcgcct
tgggtgttagcaaaagacgaagcaactttgccgaaagttcaagacgtttgtacggttgcc
ttgaacttgtttagcattttagcaacttacctgaaaccagtaatgccaaacttggttacc
gacgccgaagccttccttggcaaagagctaacttgggataaccgcagcgaattattgttt
ggcaacacggtgaacaaattcaagccgctaatgggtcgtattgagcaaaagcaaattgat
gacatgattgaagaaggcaaagcagaggccgcagtcgaagccgccgcaaaagaagcgacg
caaccggcccaagcagtaacagaactaagcaaagaaccaatcgaagccgaaatcaatttt
gatgacttcgccaaagtagatttgcgcattgctttgatcgttaaagctgagcatgttgag
aaagccaataagctactaaaattaaccttagacatcggcggtgaaactcgtaccgtattc
tctggtatcaagtcagcttataagcctgaagatttagaaggcaaatatacggtcatggtc
gcaaacttagcgccacgtaagatgaagtttggtttatctgaaggcatggtattagcggca
ggccctggtggtgaagagatctatttactagaaccacacgctggcgcgaaacctggccaa
cgcgttatgtaa

DBGET integrated database retrieval system