KEGG   Marinomonas posidonica: Mar181_2485Help
Entry
Mar181_2485       CDS       T01508                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
mpc  Marinomonas posidonica
Pathway
mpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Mar181_2485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mpc02044]
    Mar181_2485
Secretion system [BR:mpc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mar181_2485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: AEF55518
UniProt: F6CWV6
Position
complement(2736735..2737538)
Genome map
AA seq 267 aa AA seqDB search
MSEEMMDYDENSDKKSGLYDDLLFDDAENINKDKDYWFQIRGHTDNPFIDSATNFFALSL
RVKTLSDCPNIDEIYKQTIEEINITEIELTEKGYDHTVLMAYRYILCVFLDEAVMGTNWG
GDSIWAQYSMLSRFHNETWGGEKVFEIMTRLEKDPTRYKELLEFLYQCLILGFQGKFKVM
KNGKEEREKIINKLHSLLENINDKNVSLSSPTQAVVNKRYKLRRQIPVWLIFMVFSIGWV
AIYLFYYFLLNTKSQDVLDQLSQILRL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaaatgatggactatgatgagaattctgataagaaatctggattatacgat
gatttattatttgatgatgccgaaaatataaataaggataaagattattggtttcaaata
agagggcataccgataatccttttattgattcagcaactaacttttttgctctttcactt
cgagttaaaacattaagtgattgtcctaatattgatgaaatctataaacaaacaatagaa
gaaatcaacatcactgaaattgagcttactgaaaaaggttatgaccatacagtgctaatg
gcatatagatatattctatgtgtttttttagacgaagccgtaatgggaaccaattggggt
ggtgattctatttgggctcagtactcaatgctttctcggttccataacgaaacctggggt
ggtgaaaaggtttttgagatcatgactcggcttgaaaaagatccgactcgatataaggaa
ttattagaattcctttatcagtgtttgatactgggttttcaaggtaagtttaaggttatg
aaaaatggcaaagaggaaagggaaaaaataataaacaaactgcacagtttgctagaaaat
attaatgataaaaatgtgtcattaagttcgccaacgcaagctgtcgtaaacaaaagatat
aagttaagacgtcaaataccagtgtggttaatctttatggtattttcgattggttgggtc
gcaatatatttattttactattttttattgaacaccaaatcgcaagatgtacttgatcaa
ctaagtcaaattttaagattgtag

DBGET integrated database retrieval system