KEGG   Marinomonas posidonica: Mar181_2493
Entry
Mar181_2493       CDS       T01508                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
mpc  Marinomonas posidonica
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mpc02044]
    Mar181_2493
Secretion system [BR:mpc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mar181_2493
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEF55526
UniProt: F6CWW4
Position
complement(2745570..2746085)
AA seq 171 aa
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHPEETPLEERKSISIDKD
NFEAVMRESNLNLKTSVSNELDDKGGDIAVDLEFSSLADFSPDSIAAQVPELKKLIELRE
ALVALKGPLGNVAAFRNSLQSMLSSDSSREQLLAELNLVNEENADQDQPSE
NT seq 516 nt   +upstreamnt  +downstreamnt
atgtcaaaagaaggaagcgtcgctcctaaagagcgaattaatattaaatacataccagca
acgggtgatgctcaagctgaagttgaattgccattgaaaactttggttgtcggtgatttt
aaaggccatccagaagaaacgcctttagaagaacggaaaagtatttccattgataaagat
aacttcgaagcggtaatgcgcgaaagtaatttgaatcttaaaacctctgttagcaacgag
ttggatgataaaggtggcgatattgcggtagatcttgaattttcaagtcttgctgatttt
tctccagattccatcgctgctcaagtgccagagctgaaaaaactgattgaattaagagaa
gctttggttgcattaaaagggcctttagggaatgtcgctgcatttcgtaatagccttcaa
tcaatgttgtcatctgattcaagcagagaacagctgcttgcagaactcaatcttgtgaat
gaagaaaatgctgaccaagatcagccgtctgagtaa

DBGET integrated database retrieval system