KEGG   Marinomonas posidonica: Mar181_2821Help
Entry
Mar181_2821       CDS       T01508                                 

Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
mpc  Marinomonas posidonica
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Mar181_2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: AEF55851
UniProt: F6D027
Position
3125264..3125638
Genome map
AA seq 124 aa AA seqDB search
MEEYDIVVDVRTEYLARQSTPDESRYVFAYHITITNCGTHAAKLQTRHWIITNGDEQVQE
VKGSGVIGEYPHLQPGDSYQYTSGTVIETVVGVMHGSYQFIADDGTEFSAPIRPFTLSVP
NKVH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatacgatattgtggtggacgttagaaccgaatatttggccagacagtccaca
ccggatgagtctcgttatgtattcgcttaccacatcacgatcacaaactgcggaactcat
gcggctaaactgcaaactcgtcactggattattaccaatggcgatgagcaagtacaagaa
gtcaaaggcagtggcgtgataggtgaataccctcatttacaacctggggattcttatcaa
tacaccagtggcaccgtcattgagacggttgtcggtgtcatgcacggaagctatcaattc
attgctgacgatggcaccgaatttagcgcccccatacgcccattcaccctatctgttcca
aataaagttcactga

DBGET integrated database retrieval system