KEGG   Methanocella paludicola: MCP_0108Help
Entry
MCP_0108          CDS       T01142                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mpd  Methanocella paludicola
Brite
KEGG Orthology (KO) [BR:mpd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MCP_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TraQ PetG
Motif
Other DBs
NCBI-ProteinID: BAI60180
NITE: MCP_0108
UniProt: D1YUQ8
Position
complement(96812..97816)
Genome map
AA seq 334 aa AA seqDB search
MDPFLLMAIAIIVALLFDVMNGFHDTANAVATVIYTKALPPQVAIGMCAIMNMVGPFLLG
TAVAKVIATSIIPSEKLTIAIVVAGLMGAIIWDLVTWYYGLPVSSSHALIGGLVGSGLAA
IGLSGVKWGGLTNIVLALFISPVIGIVLGLVFMYLIGRFIISRMGREQANAVFKKVQILS
SAAVSLTHGSNDAQKTMGIIAMFVAVTYGTGTPVIEPWIIIACAAAIGLGTAFGGWRIIR
TLGERIGKEELSPSQGFAAETATALTIAIGSHVGAPISTTHVISSSIVGTVMAGGTGVLN
KNVVLNILTAWLLTIPVAAIGAAISYFILTLVGI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggacccgttcctgctcatggcgatagcgatcatcgtggcccttctcttcgacgtgatg
aacggcttccacgatactgcgaacgccgtggccactgtcatttatacgaaggccctgccc
ccgcaggtcgccataggcatgtgcgccatcatgaacatggtggggccgttcctgctcggg
acggccgtcgccaaggtcatcgccacaagcatcatcccttctgaaaaactgaccatcgcc
atcgtcgttgcggggctcatgggggcgatcatctgggacctcgtaacgtggtattacggc
ctccccgtaagctcttctcatgccctcatcggaggcctcgtgggctcgggcctggcggcc
atcggcctctcgggcgtgaaatggggcggcctgaccaacatcgtcctggccctttttata
tcgcccgtcatcgggatcgtcctgggccttgtctttatgtacctcatcggccggttcatc
atctcgcgcatgggacgggagcaggccaatgctgttttcaagaaggtccagatcctttcc
tctgcggccgtatcgctcactcacggctccaacgacgcccagaagaccatgggcatcatc
gccatgttcgtggccgtcacatacggcactggcacgcccgtcatcgagccatggatcatc
atcgcctgcgcggcggctatcggcctggggaccgcgttcgggggatggcggatcatcagg
acgctgggcgagcggataggaaaggaagagctttctccgtcgcagggattcgccgccgag
accgccacggcgctcaccatcgccatcggctcccacgtgggcgcccctatcagcacgacg
cacgtcatctcctcgagcatcgtcggcacggtcatggccggcggcacgggcgttttaaat
aagaacgtagtattaaatatattgaccgcgtggttattgaccatacccgtagccgccata
ggggcggcgatatcctatttcatcctgacgctggtgggaatatga

DBGET integrated database retrieval system