KEGG   Methanocella paludicola: MCP_0749Help
Entry
MCP_0749          CDS       T01142                                 

Definition
(GenBank) putative formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mpd  Methanocella paludicola
Pathway
mpd03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MCP_0749
Enzymes [BR:mpd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MCP_0749
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MCP_0749
DNA repair and recombination proteins [BR:mpd03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     MCP_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS zf-TFIIB zinc-ribbons_6 FbpA Zn_ribbon_SprT DNA_ligase_ZBD DZR Zn-ribbon_8 OrfB_Zn_ribbon Ribosomal_S13 C1_2 Lar_restr_allev TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: BAI60821
NITE: MCP_0749
UniProt: D1YWJ9
Position
722636..723445
Genome map
AA seq 269 aa AA seqDB search
MPELPEIYNLAGQMDEALKGKTIREIQIRQEKCLNMPANEFSTLVVGKKIRQVTPKGKWI
FMKLEPDGYFLLSLGMGGNLLYHRPGDNIPEKYQVALTFDDNSRLSIGFWWFGYAHAVKD
LKEHKMTHKLGVSPVDPAFTLEKFYGMLEGKKGSVKTALLDQSFIAGIGNVYAQDILFNA
KLHPDRKIPTLTEGERRALFEAIRHDLDEAIALGGIAPEKDLYGKPGRLTIDDFKAGYRE
GKPCPVCGTTIEKIKTGSTASYICPKCQR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattacccgaaatatacaatctcgccggccagatggacgaggcattgaagggt
aagaccattcgagagatccagatacggcaggaaaaatgcctgaatatgccggctaatgaa
ttttctacgctagtcgtcggcaagaagatccgccaggtcacgccaaagggcaaatggata
ttcatgaagctggagcccgacggatattttttattaagcctgggcatggggggtaacctg
ttataccaccggccgggcgacaacattcccgaaaaatatcaggtggcgttgacgttcgac
gataatagccgcctctcaataggcttctggtggttcggctatgcccacgccgtgaaggac
cttaaggagcacaagatgacccacaagctgggcgtatcgcccgtagacccggctttcacg
ctcgaaaaattctacggcatgctggaaggtaaaaagggcagcgtcaaaactgcgctgctt
gaccagtcattcatcgccggtatcggcaacgtgtatgcccaggacatccttttcaatgca
aagttgcaccctgacaggaagatacccacgctgaccgaaggcgagaggcgggcgctgttt
gaggctatccggcatgacctggacgaagccatcgcattgggcggcattgcgccggaaaag
gacctttacggtaagcccggaaggctcaccatcgatgacttcaaggcgggataccgggag
ggcaagccctgtcccgtatgcggaacgacaatagagaagataaagacgggcagcacggca
tcatacatatgcccgaagtgccagcgttag

DBGET integrated database retrieval system