KEGG   Methanocella paludicola: MCP_1256Help
Entry
MCP_1256          CDS       T01142                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase common subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mpd  Methanocella paludicola
Pathway
mpd00010  Glycolysis / Gluconeogenesis
mpd00020  Citrate cycle (TCA cycle)
mpd00620  Pyruvate metabolism
mpd00640  Propanoate metabolism
mpd00650  Butanoate metabolism
mpd00680  Methane metabolism
mpd00720  Carbon fixation pathways in prokaryotes
mpd01100  Metabolic pathways
mpd01120  Microbial metabolism in diverse environments
mpd01130  Biosynthesis of antibiotics
mpd01200  Carbon metabolism
Module
mpd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCP_1256
   00020 Citrate cycle (TCA cycle)
    MCP_1256
   00620 Pyruvate metabolism
    MCP_1256
   00640 Propanoate metabolism
    MCP_1256
   00650 Butanoate metabolism
    MCP_1256
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCP_1256
   00680 Methane metabolism
    MCP_1256
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MCP_1256
Enzymes [BR:mpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MCP_1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR DUF2178
Motif
Other DBs
NCBI-ProteinID: BAI61328
NITE: MCP_1256
UniProt: D1YY06
Position
complement(1240414..1240956)
Genome map
AA seq 180 aa AA seqDB search
MLEIRIHSRGGQGGVTASKLLAQAAFLEGKYGTAFPLYGAERRGAPVTSFTRISDHDIKV
VSQVYNPDIVIVLDDTIMDLVDVTVGLKEGGLLVVNTENGEKLKDPKYNKFRIARVNVTD
IALSLGLVLSGNPILNTPIVGAMAKLGVVKLESAEKAIRDMFSDERNVKAAEAAYEKVIV
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatacgcatccactcgagaggcggccagggcggcgtcacggcgtcgaagctg
ctggcacaggccgcgttccttgaaggcaagtacggcacggcttttccgctatatggcgcc
gagcgccgcggagcgccggtcacatcgttcacgcgcatctcggaccacgacatcaaggtc
gtgagccaggtctataacccggacattgtcatcgtgctcgatgataccatcatggacctg
gtggacgtcactgtcgggctgaaggagggagggctgctcgtcgtgaatacggagaacggc
gagaagctcaaggacccgaagtataataaattccggatcgccagggtcaatgtcacggat
atcgccctgtcgctgggcctcgtcctgtcgggtaacccgatcctgaatacgcccatagtc
ggcgcgatggcgaagctcggcgtggtcaagctcgagtccgcggaaaaagctatcagggac
atgttcagcgacgagcgcaacgtgaaggcggcggaagcggcctatgaaaaggtgatcgta
tga

DBGET integrated database retrieval system