KEGG   Methanocella paludicola: MCP_1719Help
Entry
MCP_1719          CDS       T01142                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mpd  Methanocella paludicola
Pathway
mpd00010  Glycolysis / Gluconeogenesis
mpd00020  Citrate cycle (TCA cycle)
mpd00620  Pyruvate metabolism
mpd01100  Metabolic pathways
mpd01110  Biosynthesis of secondary metabolites
mpd01120  Microbial metabolism in diverse environments
mpd01130  Biosynthesis of antibiotics
mpd01200  Carbon metabolism
Module
mpd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCP_1719 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MCP_1719 (pdhC)
   00620 Pyruvate metabolism
    MCP_1719 (pdhC)
Enzymes [BR:mpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MCP_1719 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N ATP-synt_ab_Xtn DUF2868 SWI-SNF_Ssr4
Motif
Other DBs
NCBI-ProteinID: BAI61791
NITE: MCP_1719
UniProt: D1YZB9
Position
1722868..1724085
Genome map
AA seq 405 aa AA seqDB search
MAYEFKLPDLGEGITSGEIKKWHVRKGQKVEEDQTIAEVETDKAVVELPSPVTGIVEDIK
APEGGKVNVGEVIAVIKEEGAPEAPPQPKAAEKAQEARKPEVPAPKAEAQKVPVLATPAT
RMLAKQLGVNIDSVKGTGPMGRITDEDVRSAAQKPAAKPAEAPVPAPAMKAAGKEERIPF
RGIRRTISENMIRSVSKTAQVTLVDDADLTRLVEFRERINKKLGGEVKISYLALFVKAVV
AALIAHPTLNSSLDEEKGEIVLKKYYNIGIAVDTDRGLIVPVLKDADKKSLIDISKELVH
IIELTRDGRIGIEQLKGNTFTIANIGSVGGLFSTPIINYPDVAILEMQQIRDMPRVVDGS
IVIRKVMYLPLTIDHRIVDGAEGQRFMNDLKRFLEDPEQLLVSMV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttggcgtacgagttcaagctgccggacctgggcgagggcatcacgtccggcgagatcaag
aagtggcacgtaaggaagggccagaaggtcgaggaggaccagactatcgccgaggtcgag
accgataaggccgtggtcgagctcccgtcccccgttactggtatcgtcgaggacataaag
gctcccgaaggcggtaaggtcaacgtcggggaagttatcgctgtcataaaagaagaaggg
gcgccggaggcgcccccacagccgaaggcggcggagaaggcgcaggaagcccgtaagccc
gaagttcctgcgcctaaggcggaagcgcaaaaggtaccggtactggccaccccggcgacg
cgtatgctggctaaacagctaggcgttaatatcgattctgttaaagggaccgggcccatg
ggccgcataaccgacgaggacgtgaggagcgctgcacagaagccggctgccaagcccgcg
gaggcccctgtgccggccccggcaatgaaagccgcaggaaaagaggagcgcatacccttc
cgcggcatccgcaggaccatatccgagaacatgatacggtccgtatcaaaaacagcccag
gtaacgctcgtcgacgatgcggacctgacgaggctcgtcgagttccgggagcgtattaat
aagaagctgggcggagaggtcaagatcagttaccttgccttattcgtcaaggccgtggtc
gccgcgctcatcgctcaccctactttgaattccagcctggacgaggagaagggcgagatt
gtcctaaaaaaatattacaatatcggcattgcagttgatacggacaggggcctcatcgtt
ccggtgctcaaggatgccgataagaaaagcctcatagatatttctaaggaactcgtacac
atcatcgagctaacgagggatggcaggataggcatcgagcagctcaagggcaacacgttc
acgatcgccaacatcggcagcgtcggcgggctcttttccaccccgatcattaattatccg
gatgtggctatcctcgagatgcagcagatccgggatatgccgagggtcgtggacggcagc
atcgtcatccggaaggtcatgtacctgccgctcaccatcgatcaccgcatcgtggacggc
gccgaaggccagcgtttcatgaacgacctgaagcggttcctggaagacccggagcaattg
ctcgtgagcatggtctag

DBGET integrated database retrieval system