KEGG   Methanocella paludicola: MCP_1962Help
Entry
MCP_1962          CDS       T01142                                 

Definition
(GenBank) 3-isopropylmalate dehydratase small subunit
  KO
K16793  methanogen homoaconitase small subunit [EC:4.2.1.114]
Organism
mpd  Methanocella paludicola
Pathway
mpd00300  Lysine biosynthesis
mpd00680  Methane metabolism
mpd01100  Metabolic pathways
mpd01120  Microbial metabolism in diverse environments
mpd01130  Biosynthesis of antibiotics
mpd01210  2-Oxocarboxylic acid metabolism
mpd01230  Biosynthesis of amino acids
Module
mpd_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mpd00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MCP_1962
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MCP_1962
Enzymes [BR:mpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     MCP_1962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C Aconitase_2_N
Motif
Other DBs
NCBI-ProteinID: BAI62034
NITE: MCP_1962
UniProt: D1Z012
Position
1970377..1970850
Genome map
AA seq 157 aa AA seqDB search
MKFRGKAWKYGDNVDTDVIIPGKYLRTADFKTFGDHAMEGIDPRFKPEQGDIIVAGNNFG
CGSSREQAPLALKYAGISCVVAKSFARIFFRNAINVGLPIVEADVFDAIQKGDIVEVDLD
RGLVTIGGKEYTSTKLPEFLQDILNSGGLVAYRRAKK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcaggggaaaggcctggaagtacggggataacgtggacactgatgtcattatc
cctggtaagtacctgcgaacggcggacttcaagacgttcggcgatcatgccatggagggc
atcgaccctcgattcaagcctgagcagggcgacatcatagtggccggtaacaacttcggc
tgcggctcgtcacgggaacaggcgcctctcgccctgaaatatgccggtattagctgcgtc
gtagcgaagtccttcgcacggatcttcttcaggaacgcgatcaatgtggggctgcccatc
gtggaagcggacgtcttcgatgccattcagaagggcgatatagtcgaagtggaccttgac
cgaggcctggtcaccatcggaggaaaagagtatacgagcactaagctgcccgaattcctc
caggacatattgaactcgggcggcctggtagcgtacaggagggcaaaaaaatga

DBGET integrated database retrieval system