KEGG   Mycoplasma penetrans: MYPE5100Help
Entry
MYPE5100          CDS       T00107                                 

Gene name
MYPE5100
Definition
(GenBank) dihydrolipoamide acetyltransferase of pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mpe  Mycoplasma penetrans
Pathway
mpe00010  Glycolysis / Gluconeogenesis
mpe00020  Citrate cycle (TCA cycle)
mpe00620  Pyruvate metabolism
mpe01100  Metabolic pathways
mpe01110  Biosynthesis of secondary metabolites
mpe01120  Microbial metabolism in diverse environments
mpe01130  Biosynthesis of antibiotics
mpe01200  Carbon metabolism
Module
mpe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYPE5100 (MYPE5100)
   00020 Citrate cycle (TCA cycle)
    MYPE5100 (MYPE5100)
   00620 Pyruvate metabolism
    MYPE5100 (MYPE5100)
Enzymes [BR:mpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MYPE5100 (MYPE5100)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 PTS_EIIA_1 HlyD_D23 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: BAC44300
NIH_Japan: 5100
UniProt: Q8EVQ0
Position
649128..650564
Genome map
AA seq 478 aa AA seqDB search
MYIFKFADIGEGIHEGKVSDILVKEGDSVKDGTDLFSVETDKITTEVSSPVNGVISKILI
KVGDTIHVGDPIFEIDDSNGSSSSAAPAQAPEVKSEPVVVKEEKTEQVQEGGASVVGEVK
VSNNVLPLFGSNTLNVSASVEPTKTRNDDVLASPVARVLAKNNNVDIALISGTGPEGRVT
KEDVEKYLSSSNQTTTTQTISTASESVTVAPTVTVTKTVVQSSPATAVTNAIVANKVEST
AIATIVEGDKILEMTSMRKAIANAMKRSWSNAAYTNLSVEIDVTDVWEQRNKIKDYILET
ENVKLNLLPFIIKAIAKTLKQFPIFNAINDDANGTLILRNEVNIGIAVDTKDGLIVPNIK
NADKLSIIEIAKSIADIAARARTKKITMADLQKGTFSVSNYGSLGIEFGVPVINYPEVAI
AGLGTASNKIKKVGIQMVERKVMVLTIAADHRWVDGGDIARFANQVKQYLENIAFLFV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtatatttttaaatttgctgatattggtgaagggattcacgaaggaaaagtttcagac
attcttgtaaaagaaggtgattctgtaaaagatggaacagatttattttctgttgaaact
gacaaaataacaacagaagtatcttctccagtgaatggtgtgatctcaaaaattttaatt
aaagttggagatacaatccatgttggggatccaatttttgaaattgatgatagtaatgga
tcatcttcttcagctgcaccagctcaagctccagaagttaagagtgaaccagttgttgta
aaagaagaaaaaactgaacaagttcaagaaggtggagcatcagttgttggtgaagttaaa
gtttcaaacaatgttttacctttattcggtagtaacacattaaatgttagtgcaagtgtt
gaaccaacaaaaacaagaaatgatgatgtattagctagtccagttgcaagagtattagct
aaaaataataatgttgatatcgctttaataagtggtacaggaccagaaggtagagttaca
aaagaagatgttgaaaaatacttatcttcttcaaatcaaacaactacaactcaaacaatc
tctacagcttctgaatctgttactgttgcaccaactgtaacagttactaaaactgttgtg
caatcatctccagcaactgctgtaactaatgcaattgttgctaataaagttgaatctact
gcaatcgctacaattgtagaaggtgacaaaattctagaaatgacatcaatgagaaaagca
attgctaatgctatgaaaagaagttgaagcaatgctgcttatacaaacttatcagttgaa
attgatgttacagatgtttgagaacaaagaaataaaattaaagattacattttagaaact
gaaaatgtaaaacttaacttattaccattcattattaaagcaatcgctaaaacattaaaa
caattcccaatttttaatgcaattaatgatgatgctaatgggactttaattttaagaaat
gaagttaatattggaattgctgttgatactaaagatggtttaatcgttccaaatattaag
aatgctgacaaattatcaattattgaaattgcaaaatcaattgctgatattgctgctaga
gctagaactaagaaaatcacaatggctgatcttcaaaaaggaacattctcagtatcaaat
tatggttctttaggaattgaatttggtgttcctgtaattaactatcctgaagttgcaatt
gctggtttaggaactgcttctaacaaaattaaaaaagttggaatccaaatggttgaaaga
aaagtaatggttttaactattgctgctgaccatagatgagtagatggtggagatatcgca
agattcgctaaccaagttaaacaatatttagaaaatattgctttcttattcgtttaa

DBGET integrated database retrieval system