KEGG   Mycoplasma penetrans: MYPE8690Help
Entry
MYPE8690          CDS       T00107                                 

Gene name
MYPE8690
Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
mpe  Mycoplasma penetrans
Pathway
mpe00670  One carbon pool by folate
mpe01100  Metabolic pathways
mpe01120  Microbial metabolism in diverse environments
mpe01200  Carbon metabolism
Module
mpe_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:mpe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    MYPE8690 (MYPE8690)
Enzymes [BR:mpe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     MYPE8690 (MYPE8690)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS Plasmod_Pvs28 DUF1439
Motif
Other DBs
NCBI-ProteinID: BAC44661
NIH_Japan: 8690
UniProt: Q8EUQ1
Position
1170274..1171866
Genome map
AA seq 530 aa AA seqDB search
MTNNIFKYFNIKELEKFGKFYKVKKEYEIPKKLESKLILVTSINPTPEGEGKTTTLIGIN
DCLNYFGKESIACLRQPSMGPYFGIKGGATGSGKCEIQNPEKVNCGFTNDFYAIEAANNL
IMSVIENEIYFNTDLEIDPQKIIWKRCIDINDRSLRDINYQVSKNTKINSSFSITAASNL
MALFCLAKSKSDFKKRIENTLVAFSKSNKAIYVKDLNIIDSIMLILDDALKPNLVFSQDN
NPIIMHGGPFANIAHGCNSVIALSCGLNKAEYVLTEAGFGSELGAEKFINILCRETNLVP
NLVVLTITLKAIKYHGVNNSNNTSPLTDEKEKIDIGFNNVIHHFNLLKNLNLNVCIVINK
FSDDNKNELDYLFNKSSELTKTVISTMWQDGASKNKSLFETIIESVQEPKPINWTYDLKD
NAVNKINDLSTKVYNGATITYSDLATAKLKDNENWIQDYYVCGAKTPYSPSIKNEYMDTN
KHDIHVEDIEINHAVKFIIPIFSKTFLMPGLPKVPNAKKIKINFDKFKYE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgactaacaatatttttaaatacttcaatattaaagaattagaaaaatttggaaaattt
tataaagtaaaaaaagaatatgaaatcccaaagaaactagagagtaaattaatattagtt
acctctattaatcccactcctgaaggagaaggaaaaacaacaacactaataggaattaat
gattgtttaaattattttgggaaagaatctattgcatgtttaagacaaccttctatgggt
ccttattttggaattaagggtggagctacaggaagtggaaaatgtgaaattcaaaaccct
gaaaaagtaaattgtggattcacaaatgatttttatgcaattgaagctgccaataaccta
attatgtcagtaattgaaaatgaaatatattttaatactgatttagaaattgatccacaa
aaaattatctgaaaaagatgtattgatattaatgacagatcattaagagatattaattat
caagtaagtaaaaacacaaaaataaatagtagtttctctataactgccgctagtaatttg
atggctcttttttgtttagcaaaaagcaaatcagattttaaaaaaagaattgaaaataca
ttagtagcattttcaaaatctaataaagcaatatatgtaaaagatttaaatattattgat
tctattatgttaattcttgatgatgcgctaaaacctaatttagtattttcacaagacaat
aatccaatcattatgcatggtggaccttttgcaaatattgctcatggttgtaatagtgtg
attgctttatcatgtggattaaacaaagctgaatatgtattaactgaagctggatttgga
agtgaattaggagcagaaaaattcattaacattttatgtagagaaacaaacttagttcca
aatttagtagttttaacaatcacattaaaagctattaaatatcatggtgtaaataactct
aacaacacttcacctttaactgatgaaaaagaaaaaatagatattggatttaataatgta
attcatcattttaatttattaaaaaatttaaatctgaatgtttgtattgttattaataaa
tttagtgatgacaacaaaaatgaattagattatttatttaataaatcaagtgaattaact
aaaactgtaatttcaacaatgtgacaagatggagcaagtaaaaataaatcattatttgaa
actattattgaatcagtccaagaaccaaaaccaattaattgaacctacgatttaaaagat
aatgcagttaacaaaataaatgatttatctacaaaagtttataatggagcaacaataaca
tatagtgatttagcaacagcaaaattaaaagataatgaaaactgaattcaagattattat
gtttgtggagcaaaaactccatattctccgtctatcaaaaatgaatatatggatacaaat
aaacatgatatacatgtagaagatattgaaattaatcatgccgtaaaatttataattcct
attttttcaaaaacatttttaatgcctgggcttcctaaagttccaaatgctaaaaaaata
aaaattaattttgacaaatttaaatatgaatag

DBGET integrated database retrieval system