KEGG   Mesotoga prima: Theba_0394Help
Entry
Theba_0394        CDS       T02123                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mpg  Mesotoga prima
Pathway
mpg00900  Terpenoid backbone biosynthesis
mpg01100  Metabolic pathways
mpg01110  Biosynthesis of secondary metabolites
mpg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Theba_0394
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Theba_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFK06122
UniProt: I2F2G9
Position
complement(431212..432081)
Genome map
AA seq 289 aa AA seqDB search
MVSNSSRLSSVKLRCPAKINLYLAVGKSRSDGFHEISTVFQTIDFYDDLFVKHDTRKLYF
KCNTSLRWDKENTLYKVIEQIESEIDRRIEIGLELKKRIPSGAGLGGGSSDAAALLKYLA
GLFKIDEERVLRIASNVGSDVPFFLKGGTAIASGRGEILSFPGDVSGYSVELSFPGIEVS
TPLAYEFIDEDNPELHLDCEMAEKYYLALKSHDIEAVRRMSYNTFEKSIFDRFPMIRDCH
SMLSNKNGGAIKTMMTGSGSAIFSLFEGCKGRYSFVTSEELNEKWCSMV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggtctcaaatagttctagattatcttctgttaaactgagatgcccggcaaaaataaac
ctttaccttgcggtaggtaagagcagaagcgacggattccacgagattagcactgtcttc
cagacaatcgatttctacgacgatttgttcgtaaagcatgatacaaggaagttatacttc
aaatgcaatacatctctccgctgggacaaggagaacactctttataaagtcattgagcaa
atagagagtgagatagaccggagaatagaaataggtctggaattgaagaagagaatcccc
tcgggcgcaggactgggtgggggaagttcagatgccgcagcactcctgaagtatttagcg
gggcttttcaagattgatgaagagcgagtcttgagaatcgcctcaaatgttggcagcgac
gtacctttctttctcaaaggaggaacggcgatagcttcaggaaggggagagatcttgagt
tttcccggtgatgtctctggatattcagtcgaactttccttccccggcattgaggtctca
actccccttgcttacgagttcatagatgaagataaccccgaactgcatctcgattgtgaa
atggctgagaaatactaccttgcccttaaaagtcatgacattgaagctgtaaggcgtatg
tcttacaatacgttcgaaaagtccatctttgatcgctttcccatgataagagattgccac
tcaatgctctctaataagaatggcggtgccattaagacaatgatgactggttcgggctca
gcgatcttttccctttttgagggttgcaagggaagatacagttttgttacttcagaggag
ctgaatgagaaatggtgttcgatggtctga

DBGET integrated database retrieval system