KEGG   Mesotoga prima: Theba_0428Help
Entry
Theba_0428        CDS       T02123                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
mpg  Mesotoga prima
Pathway
mpg00430  Taurine and hypotaurine metabolism
mpg00620  Pyruvate metabolism
mpg00640  Propanoate metabolism
mpg00680  Methane metabolism
mpg01100  Metabolic pathways
mpg01120  Microbial metabolism in diverse environments
mpg01200  Carbon metabolism
Module
mpg_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Theba_0428
   00640 Propanoate metabolism
    Theba_0428
  09102 Energy metabolism
   00680 Methane metabolism
    Theba_0428
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Theba_0428
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Theba_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: AFK06156
UniProt: I2F2K3
Position
466970..468199
Genome map
AA seq 409 aa AA seqDB search
MKILVINCGSSSIKYQLLDAASENVLAKGLLERIGISGSKLSHRKGEKKYEFEKDIADHT
EGLELIIEVLQSEETGVVKNINEIEAVGHRVVHGGERFASSVLIDDEVVSEIEANNFLAP
LHNPANIEGIVAAKKILPSVPHIGVFDTAFHQSMPESSYLYAIPYDLYRKYKIRKYGFHG
TSHRYVAERAAVMMERPLKELKIITAHIGNGASVAAVKNGRSVDTSMGFTPLEGLVMGTR
SGDIDPAIVPFLQEQEGLSAGEVNDLLNKESGMYGLTEGRFSDMRDIEERAMKNEPTCKR
AHDIYEYRLAKYIGAYAAAMNGVDAIVFTAGVGENSPYLRANVIDKYLGYLGISIDVEKN
KIRGKETMISTTDSKVKVFVIPTNEELVISRDTSRIVKNGLKELKLWEE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccttgtaattaattgcggctcgtcttcaattaagtaccagcttcttgatgcc
gcaagtgaaaacgtgttggcaaaagggttgcttgaaaggataggtatttccggatcaaaa
ctctctcataggaaaggcgagaagaaatacgagttcgaaaaggacattgctgatcacact
gaaggccttgaactaataattgaggttcttcagtcagaagagactggagttgtgaaaaac
atcaacgaaattgaggccgtcggtcacagagtggttcacggtggagagagattcgcatct
tccgttttaatagacgatgaagttgtaagtgagatagaagcgaacaatttccttgcacct
cttcacaatccggccaacattgagggtattgttgcagcgaagaagattcttccatctgtt
cctcacatcggggttttcgatacggcattccaccaatcgatgccagaatcatcttatctc
tacgccataccttacgacctatacagaaaatataagataagaaaatatggttttcacggc
actagccatagatatgttgcggagagagcagctgtcatgatggaaagacctctcaaagaa
ctgaaaattataactgctcatattgggaacggtgcatctgttgcggcagtcaagaacggg
aggtctgttgatacctcaatgggattcacaccgcttgaggggctcgtcatggggacgcga
tccggcgacattgatccggctatcgttcctttcttgcaggagcaagaaggattatcggct
ggggaagtaaacgacctgctgaacaaagaaagcggtatgtatgggcttactgaagggcgg
ttcagtgatatgagggatatagaggaacgtgcaatgaaaaacgagccgacttgcaaaagg
gcacatgatatatatgaatacagactggcgaaatatattggcgcttatgcggcggcaatg
aacggagtcgatgcgatagtgttcaccgcaggcgtaggagagaatagtccctacttgaga
gccaatgtgatcgacaagtacctcggctatcttggcatatcgattgatgtagagaaaaat
aaaatcagaggaaaagagaccatgatttccacaactgattcgaaggtaaaagtcttcgtt
atcccaactaatgaggaacttgttatctctagagataccagtaggatagttaagaatggt
ttgaaggaattgaaactgtgggaagagtga

DBGET integrated database retrieval system