KEGG   Mesotoga prima: Theba_0729Help
Entry
Theba_0729        CDS       T02123                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mpg  Mesotoga prima
Pathway
mpg00230  Purine metabolism
mpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Theba_0729
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Theba_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 ATPase_2 AAA_16 cobW AAA_22 RsgA_GTPase AAA_23 CobN-Mg_chel AAA_30 ABC_tran Viral_helicase1 AAA AAA_29
Motif
Other DBs
NCBI-ProteinID: AFK06446
UniProt: I2F3E3
Position
775753..776376
Genome map
AA seq 207 aa AA seqDB search
MKGIVFVMSGPSGAGKTSILREVLRSNNNLDFSVSYATRERRPEEVQGKDYFFVTPEEFK
RLQKEDEFLEWAKVHGNYYGTSRHQVSKSVDLGRDILLDVDIQGAMSLMSKLRDAVYIFV
APPSYEELISRLQSRGTEDTQSLRTRLEDAKWELEQVKNFQYLVINDNLKHSVSQFEAII
TAERLRVDRMVREKGERFLFEEKTYDN
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtatagtctttgtgatgagcggtccttcaggggccggaaaaacctcgatactc
agagaagtactccgatccaacaataatctcgacttttcagtttcttatgctacgagggaa
agacggcctgaggaagttcagggaaaggattatttttttgtcactccggaggaattcaaa
cgacttcagaaagaagatgagtttttagaatgggcaaaagtccatgggaattattatggg
acctctagacatcaggtcagcaagagcgtagatttgggcagagatattctgcttgatgtg
gacattcagggggccatgtcattaatgagcaaactccgagacgccgtctatatatttgtc
gcaccgccatcttacgaagagctgatcagtcgccttcagtcaaggggaacagaagacact
caatctctaagaacaaggctcgaagatgcaaaatgggaacttgaacaggtgaagaacttt
cagtatctcgttattaatgataatttaaagcattcggtaagtcaatttgaagcaatcatc
accgccgaaaggttgcgtgttgatagaatggtcagagaaaagggagaaagattcttgttt
gaggagaaaacatatgataattaa

DBGET integrated database retrieval system