KEGG   Mesotoga prima: Theba_1254
Entry
Theba_1254        CDS       T02123                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
mpg  Mesotoga prima
Pathway
mpg00472  D-Arginine and D-ornithine metabolism
mpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Theba_1254
Enzymes [BR:mpg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Theba_1254
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2067
Other DBs
NCBI-ProteinID: AFK06942
UniProt: I2F4T9
Position
1318533..1318922
AA seq 129 aa
MMSIQRSDDFEKRSVHLKNLTDEELDRRFWELADKIVEPLIDLAKANTSPSIERSVLLRM
GLDSLQAGSIVTKAVEHGLLGKGAGNIVLTYAKMNSLTLEKAVEELAVGKGWEALVSNFR
GGDRNVARQ
NT seq 390 nt   +upstreamnt  +downstreamnt
atgatgtctattcagagaagtgatgatttcgagaagcggagtgtgcatcttaagaatcta
accgacgaggagctcgacagaagattctgggagctggctgataagattgtagaacccttg
atagatcttgcgaaggctaatacaagcccttcaatcgaacgttctgtgcttcttagaatg
gggctggatagtttgcaggctggatcaatagtcacgaaggccgtcgaacacggtttgctc
gggaagggcgccggaaatatcgttctaacctacgcgaagatgaattcactgaccctggaa
aaggcggttgaagaactagctgtcggaaagggatgggaagctctcgtttctaacttcagg
ggaggcgatcgtaatgttgcccgtcaatga

DBGET integrated database retrieval system