KEGG   Mesotoga prima: Theba_1366Help
Entry
Theba_1366        CDS       T02123                                 

Definition
(GenBank) protein-L-isoaspartate carboxylmethyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mpg  Mesotoga prima
Brite
Enzymes [BR:mpg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Theba_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 MTS Methyltransf_25 RrnaAD Methyltransf_18 DOT1 Methyltr_RsmB-F PrmA Methyltransf_4 Methyltransf_11 Methyltransf_3 Amino_oxidase Ubie_methyltran Met_10 GidB Methyltransf_32 Methyltransf_15 GCD14 Methyltransf_5 Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: AFK07054
UniProt: I2F551
Position
complement(1446141..1446857)
Genome map
AA seq 238 aa AA seqDB search
MRNEMIDLIRYLKKLGYLKDPRIEAAMMELDRADFVSSEVRDRAYEDIALLSFGSSGKVC
STSTQPSLLVTMIEELGMRDEDRVLDLGTGTGFCACILGKMAKKGSVITVEKDREVASVA
SRNFERYRMKNVRLVIGDGRYGYESDAPYDKIISTVALSGMSEVLFSQMKIGGRCVSPIY
RSYMDTPVFLFERTDDTTLKVSEITGAVFMVAEESEPDPIYHNREFSLRLTDGRFQII
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacgagatgattgatcttataagatacttgaagaagttgggatacttgaaagac
ccgcgaatagaggccgccatgatggagcttgatcgggccgatttcgtctcttccgaagtg
cgcgacagggcatatgaggacatagcccttttgagctttggcagttctggcaaagtatgc
tccacttcgacccaaccgtcgcttctcgtgacgatgatcgaggagttgggaatgagagat
gaagatagggtgttggatctgggaacgggaactggtttctgtgcctgcatacttgggaag
atggcaaagaagggaagtgtaatcaccgtagaaaaggacagagaagttgcttcagtcgct
tcgagaaatttcgagcgctatcgtatgaaaaacgttcgccttgtgattggtgacggacgg
tacggttatgaaagcgacgctccttacgacaaaataatctcaacggttgcactctcggga
atgagtgaagtgctcttcagtcagatgaaaattggagggaggtgcgtatctccaatttac
aggagttacatggatactcctgttttcctattcgaaagaaccgacgatacgactttgaag
gtttcggagataaccggagccgttttcatggtggcagaggagtcagaaccggatcctatc
tatcacaacagagagttcagcctcagattgacagacggaaggtttcaaatcatctga

DBGET integrated database retrieval system