KEGG   Mesotoga prima: Theba_2678Help
Entry
Theba_2678        CDS       T02123                                 

Definition
(GenBank) acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-like deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mpg  Mesotoga prima
Pathway
mpg00300  Lysine biosynthesis
mpg01100  Metabolic pathways
mpg01120  Microbial metabolism in diverse environments
mpg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Theba_2678
Enzymes [BR:mpg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Theba_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFK08277
UniProt: I2F8M4
Position
complement(2914695..2915798)
Genome map
AA seq 367 aa AA seqDB search
MKLSDKELEKLLLELCSANTTNPPGNEDRAVEILQRVLVDRNVHIEIQKVAENRSNLVAR
LQRDPALPYLLLSGHMDVVPAGSNWDSDPFKPKLVDGKLFARGSADMKGGLSALTAALID
LSEDSDFSWNVALIATCDEEVGCSGIRHFLEHQTFDVSGVIIGEPTSLRLATGEKGAIWL
KLKFRGKSAHGSQPQNGINAVTKLFSAYTELSQVLGKIEGLTESLNIIRGGSKENTVPDE
AECVIDIRFAENTDSAEIIALVDSVLSKYNQSERIILLNRESFSSSGNLTESVKEVLKEK
AMNAEELTMTYFTDGAFTASQGIETVILGPGSPSMAHRSNEYVELEEVHMARRLYSKIAR
NYFERTR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgagcgataaagaactcgaaaagcttctgctagagctttgcagcgcaaataca
acaaatcctcctggaaacgaagatcgagccgttgagattcttcagagagtgcttgtagac
aggaacgttcatattgagatacagaaagtcgcagagaatcgctcaaatcttgtcgcaaga
cttcaaagagacccggccttaccttaccttctcctgtcaggtcacatggacgtagtaccg
gctggatcaaactgggactcggatcccttcaaaccgaaacttgtggacggcaagttgttt
gcgaggggttcagcagacatgaagggcgggttaagcgccctaactgcagctctaatagat
ctttcggaagacagcgatttttcttggaatgttgcgctcattgcgacctgtgatgaagaa
gtcggctgctcagggatacgccattttctcgagcatcaaacctttgacgtttcaggcgta
atcattggtgagcctacctccttgagacttgcgacaggtgaaaaaggggcgatatggctt
aaactgaaattcagaggcaaatcagcgcacggttcgcaaccgcaaaacggaatcaacgca
gttacaaagcttttcagtgcctacactgagctttctcaggttctcgggaaaatagaaggg
cttactgagagcctgaacatcattcgaggtggatcgaaagaaaataccgttcccgatgag
gccgaatgtgttatcgacattcgttttgcagagaacacagattctgcagaaatcatcgct
ctggtagattccgttctaagcaaatacaatcaatcagagagaattatattgctcaacagg
gagtctttctcctcttccggcaatctcaccgaatctgttaaagaagtgcttaaagagaag
gctatgaacgcagaagagctcacgatgacctattttactgatggcgcctttactgcatcg
caagggattgagacggtaatactaggtcccggaagtccctcaatggcacacaggtcgaac
gaatatgtggaacttgaagaagttcatatggcccgtaggctgtattcaaaaatagcaagg
aactactttgaaaggactagataa

DBGET integrated database retrieval system