KEGG   Microlunatus phosphovorus: MLP_00530Help
Entry
MLP_00530         CDS       T01535                                 

Gene name
pit
Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mph  Microlunatus phosphovorus
Brite
KEGG Orthology (KO) [BR:mph00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MLP_00530 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2798
Motif
Other DBs
NCBI-ProteinID: BAK33067
UniProt: F5XGG0
Position
53608..54783
Genome map
AA seq 391 aa AA seqDB search
MDWLLISVIAVIALALLFDFTNGFHDAANSVATVVATKALPARLAPWFSAFFNFSAFFVV
GTAVANTVAKVVNHDVEGVAVVFAALVAAIAWNYFTWYVGMPSSSSHAIIGGLVGAGLAA
GGTGAVNWGVVSKAVLAIVVSPLVAFTIAAVAMLILARIHKQWNLSEDAKAYKGLQLVSA
AAVSFGHGANDAQKTMGIMAAVLAAGGYIGLQADGTFEIDWWIPLLAYSAISIGTVWGGW
KIIETMGLRITKLRASSGLAANVGAVTAIFGATGLGIPISTTHAAASSVAGAGVASGKGV
NGRVIREMVTAWVVTIPATVIVGFVMFKLTRLPGISAYLVVGAIMAALLTWIVWAMSKAM
GADDLAKELPSDAETRQPVAATRADGHGTGE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggactggctactgatctccgtgatcgctgtcatcgcgctggcgctgctgttcgatttc
accaacggattccatgatgcggccaactcggtcgccaccgttgtcgcgacgaaagcacta
ccggcccgattggctccgtggttctcggcgttcttcaatttctcggcgttcttcgtcgtc
gggaccgctgttgcgaacaccgtggcgaaagtggtcaatcacgatgtggagggagttgcg
gtcgtcttcgcggcgctggtcgcggcgatcgcctggaactacttcacctggtacgtggga
atgccttcctcctccagtcacgcaatcatcggcggcctggtgggcgccgggctcgcggcc
ggaggcaccggcgcggtcaactggggcgtggtcagcaaggcagtgcttgccatcgtggtc
tcgcccttggtggctttcaccatcgctgccgtggccatgctgatcctggccaggatccac
aagcagtggaacctcagcgaggatgccaaggcctacaagggtctgcagctggtctcggcc
gccgcggtctccttcggtcatggcgccaacgacgcgcagaagacgatgggcatcatggcc
gccgtgctcgccgccgggggatacatcggactgcaggcggacggcaccttcgagatcgac
tggtggattccgctgctggcctattcggcgatctccatcggcaccgtctggggcggttgg
aagatcatcgagacgatgggtctgcgcatcaccaagctgcgcgccagctcgggtctggcc
gccaacgtcggcgccgtgacggcgatcttcggtgccaccggattgggcatcccgatctcc
accacgcatgccgctgcctcctcggtcgccggcgccggtgtggcctcgggcaagggcgtg
aacggccgggtcatccgcgaaatggtgaccgcctgggtggtcacgatccccgcgacggtg
attgtcggcttcgtgatgttcaagctcacccggctgccgggcatctcggcttacctggtc
gtaggcgccatcatggcggcgctgctcacctggatcgtctgggcgatgtcgaaggcgatg
ggtgccgacgatctcgccaaggagctcccgtcagatgcggagacacgtcagccggttgcc
gccacgcgtgctgacggccacgggaccggcgagtga

DBGET integrated database retrieval system