KEGG   Microlunatus phosphovorus: MLP_04360Help
Entry
MLP_04360         CDS       T01535                                 

Gene name
bkdC
Definition
(GenBank) dihydrolipoamide acyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00010  Glycolysis / Gluconeogenesis
mph00020  Citrate cycle (TCA cycle)
mph00620  Pyruvate metabolism
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
mph01120  Microbial metabolism in diverse environments
mph01130  Biosynthesis of antibiotics
mph01200  Carbon metabolism
Module
mph_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_04360 (bkdC)
   00020 Citrate cycle (TCA cycle)
    MLP_04360 (bkdC)
   00620 Pyruvate metabolism
    MLP_04360 (bkdC)
Enzymes [BR:mph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MLP_04360 (bkdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: BAK33450
UniProt: F5XJC4
Position
486854..488290
Genome map
AA seq 478 aa AA seqDB search
MAIKEFRLPDPGEGLVEADIVTWRVAVGDQVKINDILVEIETSKSLVELPSPYEGTVTGL
LVSEGDTVDVGVPIIAIDDGVAAPSAPAAPAEAADGDRVANLVGYGPKQTDSRRRPRKGA
AGGPEAETHEQVNSTFAVSAPVSRRADEREPLQSTAAQSHGGPLPQPGPAAAETSPPSTG
PVLAKPPVRKLARDLGIDLAAVAGTGSGGVITRADVEAAAAAPAAEVVAGPSFAAPPVSA
AAEDQRIPIKGVRKAMAAAMVQSAFTAPHVTVWVETDVTATMDLVQAIRARRDFAEVKVS
PLLIVAKAVLIALKRNPALNSSWDEVAQEIVLKAGVNLGIAAATPRGLIVPNIKNADRLS
LLELAQAFAALISSARSGKTTPEEMARGSFTITNIGVFGVDGGLPILNPGEAGILAVGQI
VRKPWVVGSGDDERIEPRWVTTIGLSFDHRLADGQQGSTFLADVAAILADPGMALVLS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaaggagttccggctgcccgatccgggcgaagggctggtcgaggccgacatc
gtcacctggcgggtcgccgtcggtgaccaggtcaagatcaacgacatcctggtggagatc
gagaccagcaagtcgctggtcgagctgccgagtccgtacgagggcacagtcaccggtctg
ctggtgagcgaaggcgacacggtcgacgtcggcgtaccgatcatcgccatcgacgacggc
gtggcggcgcccagcgctccggctgctccggcggaggcagcggatggtgaccgggtcgcg
aacctggtcggctacgggccgaagcagaccgacagcaggcgccgaccgcgcaagggtgct
gccggtggcccggaagccgagacacacgagcaggtcaacagcacgttcgcagtcagcgcg
ccggtctccaggcgtgcggatgagcgggagccgctgcagtcgacggccgcgcagtcgcac
ggtggtccgctgccgcagccaggtccggctgccgccgagacgtctccgccgtcgaccggt
ccggtgctcgccaaaccgccggtacgcaagctggcccgcgacctgggcatcgatctggcc
gccgtcgccggaaccggttcgggcggcgtgatcactcgcgccgacgtcgaggcggcggct
gctgctccggccgccgaggtcgttgctgggccatcgttcgcggcaccgccggtctccgcg
gccgccgaggaccagcggattccgatcaagggtgtccgcaaggcgatggcggccgcgatg
gtgcagtcggcgttcaccgcaccgcatgtcacggtctgggtggagaccgatgtcaccgcc
accatggacctggtgcaggccatccgggcccgtcgtgacttcgccgaggtcaaggtctcg
ccgctgctgatcgtcgccaaggcggtgctgatcgcgctgaagcgcaatcccgcgctcaac
tcatcgtgggacgaggttgcccaggagattgtcctcaaggccggggtgaacctggggatc
gccgccgccacgccgcgcgggctgatcgtgcccaacatcaagaacgccgatcggctgagc
ttgctggagttggcgcaggcgttcgcggccttgatcagttcggctcgatctggcaagacc
acgcccgaggagatggcccgcggcagcttcacgatcaccaacatcggcgtgttcggggtc
gatggtggcctgccgatcctcaacccgggcgaggccgggatcctggccgtcggtcagatc
gtccgcaagccgtgggtggtcggttccggcgacgacgagcggatcgaaccgcgttgggtg
accacgatcggactgtccttcgaccaccgcctcgccgatggccagcagggctcgaccttc
ctggccgacgttgcggcgatcctggccgacccaggcatggcactggtcttgtcctga

DBGET integrated database retrieval system