KEGG   Microlunatus phosphovorus: MLP_29290Help
Entry
MLP_29290         CDS       T01535                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
mph01130  Biosynthesis of antibiotics
mph01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MLP_29290 (trpC)
Enzymes [BR:mph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MLP_29290 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth TMP-TENI FMN_dh
Motif
Other DBs
NCBI-ProteinID: BAK35943
UniProt: F5XJP3
Position
complement(3158331..3159134)
Genome map
AA seq 267 aa AA seqDB search
MSALDEIIAGVREDLALRQATTSLDRLKDRVKIVDPAIDPMPRFRGPGVAVIAEVKRSSP
SKGALATIDDPAALAAEYEAGGAAAISVLTEQRRFSGSLDDLVSVRCAVAVPVLRKDFIV
TSYQLFEARAAGADLVLLIVAALNDAELTSLIERARSIGMTPLVEAHTADEVRRALDAGA
DVIGVNARNLATLEVDPLTFARLAPLIPDGVVRIAESGVRGPHDVIELARHGADVVLVGE
ALVTGRDPRAGVADLVAAGAHPALHKS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcactcgacgagatcatcgctggggtccgtgaggacctcgcactccgccaggcc
accacgagcctggatcggttgaaggaccgggtcaagatcgtcgacccggccatcgacccg
atgccgcgtttccgcggcccgggtgtcgccgtgatcgccgaggtgaagcgctccagcccc
agcaagggcgctctggccacgatcgacgatcccgccgcgctggccgcggagtacgaggcc
ggtggcgcggcagcgatctcggtgctcaccgagcagcgccggttcagcggctcgctggac
gatctggtcagcgtccgatgcgcggtggcggtgccggtgcttcgcaaggacttcatcgtc
acctcctaccagttgttcgaggcgcgcgcggccggcgccgacctggtgctgctgatcgtg
gccgcgctcaatgacgccgagctgacgtcgctgatcgaacgagcccgctcgatcgggatg
accccgttggtggaggcacacaccgccgacgaggtgcgccgggcgctcgacgccggcgcc
gatgtgatcggagtgaacgcccgcaacctggcgaccctcgaggtggacccgctcaccttc
gcaaggctggcgccgctgattcccgacggcgtggtccggatcgccgagtcaggcgtacgc
ggtccgcacgatgtcatcgagctcgcccgccacggcgccgacgtggtgctggtcggcgag
gccctggtcaccggccgggacccccgggccggggtcgcagatctcgtcgcggccggcgcc
cacccggccctgcacaagtcttga

DBGET integrated database retrieval system