KEGG   Microlunatus phosphovorus: MLP_29720Help
Entry
MLP_29720         CDS       T01535                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00500  Starch and sucrose metabolism
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MLP_29720 (glgB)
Enzymes [BR:mph01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MLP_29720 (glgB)
Exosome [BR:mph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MLP_29720 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase HC2 DUF3459 Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: BAK35986
UniProt: F5XKB4
Position
3201564..3203819
Genome map
AA seq 751 aa AA seqDB search
MAFDPGGELTGWDLTGFHQGHDTEAWRRLGAHEITVTDSERGEISGTRFSVWAPNAQAVR
LAGDFNYWNDESSPMQLVPGSGVWSLFVEGVGTGTLYKFEVLGADGVWRLKADPFARFCE
APPHNASIVYESQYEWGDDQWLWFRGQKKQYEEPVSIYEVHLGSWRKGLTYVELARQLVE
YVSWQGYTHVELMPVAEHPFDGSWGYHVTGYYAPISRFGSPDEFRYLVDELHKAGIGVLV
DWVPGHFATDPWALQRFDGTALFEHEDPRLGWHPDWGSYIFNFGRNEVKSFLVSNAYYWL
DEFHIDGLRIDAVASMLYLDYSREAGQWVPNKFGGNENLEAVELLQTVNAHNYRRKPGIM
MVAEESTSWPGVTRAVDDGGLGFGFKWNMGWMNDSLRYYGRDPLYRQYHHHEMTFAMAYA
YSENFVLPISHDEVVHGKGSMFERAPQDEWRKFGTMRAFYAFMWAHPGKKLLFMGTEFGQ
RREFAETRSLDWDESAHWGHRGVQRLVKDLNTVYKAHPALYALDTDPAGFRWINADDAGG
NVFSWVRFDGDGQMIACITNFSADPRPDYRVGLPAEGAWVEIMNTDAAVYDGTGKIGNLG
QVIAHPVPSNGFPASANVTIPPLGAVWLLFQPTPTEESDEPEKVEAGTRAAAKQASPRRR
EPAAVEPAEEELAGEELADTGDEGSATPAKKTPARKSPAKKTPAKAAARKTSSAAAAKKA
TTKKTPAKSTATKKTTTRKSAAKKTTPPPEA
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaccccggcggtgagctgaccggttgggacctgaccgggttccatcagggg
catgacaccgaggcctggcgccggctcggtgcgcacgagatcacggtgaccgattccgag
cggggcgagatctcgggcacccggttctcggtctgggcgccgaatgcccaggcggtgcgg
ctggcgggcgacttcaactactggaacgacgagtcctcgccgatgcagctggtgccgggt
tccggggtctggtcgctgttcgtcgagggcgtcgggaccggcacgctctacaagttcgag
gtgctcggggccgatggtgtctggcggctgaaggcggatccgttcgcccggttctgcgag
gcgccgccgcacaacgcctcgatcgtgtacgagtcccagtacgagtggggcgacgaccag
tggctgtggttccggggccagaagaagcagtacgaggagccggtcagcatctacgaggtg
catctgggctcgtggcgcaagggcctcacctatgtcgagctcgctcggcagctggtggag
tacgtgtcctggcagggctacacccacgtcgagctgatgccggtcgccgagcacccgttc
gacgggtcctggggctatcacgtcaccggctactacgcgccgatctcccggttcggctcc
cccgacgagttccgctacctggtcgacgagctgcacaaggccggcatcggggtgctggtc
gactgggtcccgggtcacttcgccaccgatccgtgggcgctgcagcgcttcgacggcact
gccctgttcgagcacgaggatccgcggctgggctggcatcccgactggggctcctacatc
ttcaacttcggccgcaacgaggtgaagagcttcctggtctccaacgcctactactggctg
gacgagttccacatcgacgggttgcggatcgacgcggtcgcctcgatgctctatctggac
tactcccgcgaagccggccagtgggtgccgaacaagttcggcggcaacgagaacctcgag
gccgtcgagctgttgcagacggtgaacgcgcacaactaccggcgcaagcccgggatcatg
atggtcgccgaagagtcgacctcatggcccggagtcacccgagcggtcgacgacggcggc
ctgggattcggcttcaaatggaacatgggctggatgaacgactcgctccgctactacggg
cgagacccgctctaccggcagtatcaccaccacgagatgacgttcgcgatggcgtacgcg
tactcggagaacttcgtgctgccgatcagccacgacgaggtcgtgcacggcaagggctcg
atgttcgaacgggcgccgcaggacgagtggcgcaagttcggcacgatgcgggcgttctat
gccttcatgtgggcgcatccgggcaagaagctgctcttcatgggcaccgagttcggccag
cggcgggagttcgccgagacccgcagtctcgactgggacgagagcgcccactggggtcac
cgcggtgtgcagcgcctggtcaaggacctgaacaccgtctacaaggcgcatccggcgctg
tatgccctggacacggatccggccggcttccggtggatcaacgccgacgacgccggcggg
aacgtgttctcctgggtgcgcttcgacggcgacggccagatgatcgcctgcatcaccaac
ttctccgccgacccccggccggactatcgcgtcgggctgccggccgaaggggcctgggtg
gagatcatgaacaccgatgccgcggtctatgacggcaccggcaagatcggcaacctcggc
caggtgatcgcccatccggtgccctccaacgggttcccggcgtcggccaatgtgaccatc
ccgccgctcggtgcggtgtggctgctgttccagccgaccccgaccgaggagtccgacgag
ccggagaaggtcgaggccggtacgcgggcagcggccaagcaggcttcgccgagaaggcgc
gagcccgcggccgtggagccggccgaggaggaactggccggggaggaactggccgacacc
ggagacgaagggtcggcgacacccgcgaagaagacgccggccaggaagtctcctgccaag
aagactcctgccaaggcggcggcgcggaagaccagctcggccgcggcggcgaagaaggcg
accaccaagaagactcctgccaagtcgaccgctacgaagaagacgaccactcggaagtct
gcggcgaagaagaccaccccaccgccggaggcgtga

DBGET integrated database retrieval system