KEGG   Microlunatus phosphovorus: MLP_41160Help
Entry
MLP_41160         CDS       T01535                                 

Gene name
rluD
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
mph  Microlunatus phosphovorus
Brite
KEGG Orthology (KO) [BR:mph00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mph03009]
    MLP_41160 (rluD)
Enzymes [BR:mph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     MLP_41160 (rluD)
Ribosome biogenesis [BR:mph03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MLP_41160 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 DUF2293 PvlArgDC
Motif
Other DBs
NCBI-ProteinID: BAK37130
UniProt: F5XRR7
Position
complement(4407415..4408338)
Genome map
AA seq 307 aa AA seqDB search
MSEPRVLLVPEGLEGERVDTAVSRMLGVSRSRVAELAADGSVVVDGQVAGKSDRIRAGSV
LEVILGEPRTATVQPMIAAGLTVVYDDDDIVVIDKPVGVAAHPSVGWSGPTVLGHLAAAG
FRISTSGVPERQGIVQRLDVGTSGLMVVAKSEIAYSVLKQAFRSRTVDKTYHTLVQGHPD
PFTGTIDAPIGRHPSAEYKMAITANGRHSVTHYDTLDAFVGSTLLEVHLETGRTHQIRVH
MAAIHHPCVGDPMYGGDPVLAARLGLERQWLHAVRLGFVHPVRGEYVTFESDYPDDLRHA
LDMVRDA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagccacgcgtgctcctggtgcccgaagggctggagggggagcgagtcgacacc
gcagtctcccggatgctcggggtgtcccgcagccgggtcgctgagctggccgccgacgga
tcggtggtggtcgacggccaggtggcgggaaagtccgaccggatccgggcggggtcggtg
ctcgaagtgatcctcggtgagccccggacggcgactgtgcagccgatgatcgcagcgggg
ctgacggtggtgtacgacgatgacgacatcgtggtgatcgacaagccggtcggcgtcgcc
gcccatcccagtgtcgggtggagcggtccgaccgtgctgggtcacctggccgcggcgggt
ttccggatctcgacctccggggtgccggagcgacaagggatcgtccaacggctcgacgtc
ggcacctctgggctgatggtggtggcgaagagcgagatcgcgtacagcgtgctgaagcag
gccttccgttcccggacggtcgacaagacgtaccacaccctggtccagggccatcccgat
ccgttcaccggaaccatcgacgcaccgatcgggcggcatcccagtgccgagtacaagatg
gccatcacggccaacggccggcacagcgtgacccactacgacacgctggatgcgttcgtg
ggcagcaccctgttggaggtccatctggagaccggacggacacaccagatccgggtgcac
atggcagcgatccatcacccgtgcgtcggcgatcccatgtacggcggcgatccggtgctc
gccgcccggctcggtctggagcggcagtggctgcatgcggtccggttgggtttcgtccac
ccggtacggggcgagtacgtgaccttcgagtccgactatcccgacgacctccggcacgct
ctcgacatggtgcgggacgcctga

DBGET integrated database retrieval system